(data stored in ACNUC7421 zone)

EMBL: CP000431.PE47

CP000431.PE47        Location/Qualifiers
FT   CDS_pept        53898..54266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91883"
FT                   /db_xref="GOA:Q0SKQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ3"
FT                   /protein_id="ABG91883.1"
FT                   /translation="MRAPLSHRCGRGRRTTSEPVGEGTRNIMFEGHATASPCDDRHRRD
FT                   DEPEEFLYVHPAGFALSVVTGAAAAGLVVLLGAWLATPLVGVGAAATLVATVGLAAAML
FT                   MPHRPRRHGTRPVRSTAR"
     ttgcgcgcgc cgttatcgca ccgttgtgga agaggccgac gcacgacatc tgagcccgtc        60
     ggcgagggaa cgaggaacat catgttcgaa ggccacgcca ccgcatcgcc gtgcgacgat       120
     cgtcaccgcc gagacgacga acccgaggag tttctgtacg tgcatcccgc cgggttcgca       180
     ctctccgtgg tgacaggggc agcggccgcc ggcctggtcg tcctgctcgg cgcctggctc       240
     gcaaccccgc tcgtcggagt cggcgctgcc gcgacacttg tcgccaccgt cggcctggcg       300
     gcggccatgt tgatgcccca tcgaccacgc cggcatggga cgcgcccggt tcgttccact       360
     gctcgatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page