(data stored in ACNUC7421 zone)

EMBL: CP000431.PE49

CP000431.PE49        Location/Qualifiers
FT   CDS_pept        55092..56813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00049"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91885"
FT                   /db_xref="GOA:Q0SKQ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ1"
FT                   /protein_id="ABG91885.1"
FT                   /translation="MTRQPDAGDRGPLLGSLSELRLRELLAEVQERIEQIVDARDHVDG
FT                   LLEAMLAVTSGLDLDNTLHTIVHAAINLVDARYGALGVLGPGGGLSEFVFEGIDEETRE
FT                   RIGDLPRGRGVLGFLITNPKPVRLDDLSHHSASVGFPAEHPPMKTFLGVPIQIRDEVFG
FT                   NLYLTEKANGSQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIATELL
FT                   AGSETAEVLQVIADDALALTGADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRIIGR
FT                   TIPVDKSTSGEAFRERTPLRVTALAFDPGFETGTRFGPALALPLRAAQSVTGVLVTLRH
FT                   VDALPFTDDQLALMSGFADQAAVALQLANSQRRMRELDVLSDRDRIARDLHDHVIQRLF
FT                   AVGLSLQSTLQRAKAPIVKQRLEQSIDDLHDIVRDIRTAIFDLHGGSGGMTQFRRRLHE
FT                   IVAETTADSGLRTTVHMSGPLSVIDAALADHAEAVLREALSNAVRHAGADTVTVSISVY
FT                   DDLAIEVADDGKGFVENVVTSGLENLAARAREVNGHFAIDTTPGGGTTLRWTAPLP"
     gtgacccgtc aaccggatgc gggcgaccga ggtccgttac tcggtagtct gtccgagctt        60
     cggctccgtg agctcctggc cgaggtgcag gagcgcatcg agcagatcgt cgatgcccga       120
     gatcacgtcg acgggctgct cgaggcgatg ctcgcggtca cgtcgggact cgacctcgac       180
     aacacgctcc acaccatcgt ccatgctgcg atcaatctgg tggatgcccg ctacggcgcg       240
     ctgggggtgc tcggcccggg tgggggcctg agtgagttcg tcttcgaggg catcgacgag       300
     gagacccgcg agcgtatcgg cgacctgccc cgtggtcgcg gggtcctcgg ttttctcatc       360
     accaatccga agccggtccg gctggatgac ctgtctcatc actccgcgtc ggtgggattc       420
     ccggccgagc acccgccgat gaaaaccttt ctgggagttc ccattcagat ccgggacgag       480
     gtgttcggga atctgtatct gacggagaag gctaacgggt cacagttcac cgaggacgac       540
     gaggtccttc tccgcgcgct cgcggccgcg gccgggatcg cgatcgagaa cgcccgcctg       600
     tacgaggagt cccggacgag gcaggcgtgg ctcgaagcga cgcgggagat cgcgaccgaa       660
     ctactcgcgg gcagcgagac cgccgaggtg ctgcaggtga tcgccgacga cgcccttgcc       720
     ctcaccggcg ccgacagtgc ctttctcgcg gtaccggacg atcccgacat cccgtcggac       780
     gaggtcaccg agctcgtggt gacggcatcg gcggggacgg tgtcggatcg gatcatcggc       840
     cggacgatcc cggtcgacaa atccacgtcc ggcgaggctt tccgcgaacg gacaccgctt       900
     cgcgtcacgg cgctggcgtt cgaccccggg ttcgagacgg gaacccggtt cggtccggcg       960
     ctggcgctgc cgctgcgtgc cgcgcaatcg gtgacggggg tgctggtgac gctccgccac      1020
     gtcgacgctc tgccgttcac cgacgaccag ctggcgctga tgtcggggtt cgcagaccag      1080
     gcggccgtcg cgttgcagct ggccaacagt caacgccgaa tgcgtgagct cgacgtcctg      1140
     tccgatcggg atcgcatcgc gcgcgacctc cacgaccacg tcattcagcg cctcttcgcg      1200
     gtcggcctgt cgctgcagag caccttgcag agggcgaagg ctccgatcgt caagcagcgg      1260
     ctcgaacagt cgatcgacga ccttcacgac atcgtgcgtg atatccgtac cgccatcttc      1320
     gaccttcacg gcggttcggg ggggatgacc cagttccggc ggcggctgca cgagatcgtc      1380
     gccgagacca ccgcggattc cggactccgc acgaccgtgc acatgtccgg gccgctgtcg      1440
     gtcatcgacg ccgcgctcgc cgaccatgcc gaggctgtcc tgcgtgaggc gttgagcaac      1500
     gcggtacggc atgcaggagc cgacacggtc acggtcagca tctccgtcta tgacgatctc      1560
     gccatcgagg tcgcggacga cggcaaaggt ttcgtggaga acgtcgtcac cagcggattg      1620
     gaaaatctgg ctgcccgggc gcgggaagtg aacgggcact tcgccatcga cacaaccccc      1680
     ggtggcggaa ccactctccg gtggacggct ccgctgccgt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page