(data stored in ACNUC7421 zone)

EMBL: CP000431.PE5

CP000431.PE5         Location/Qualifiers
FT   CDS_pept        6935..8449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00005"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91841"
FT                   /db_xref="GOA:Q0S093"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S093"
FT                   /protein_id="ABG91841.1"
FT                   /translation="MHQLSSLDAQFLDAETSTTCTHVGILSVLGPTTPGGGLTVQALRA
FT                   LADGRLHLVGPLRWRLQQVPLGLDRPYWVDSEFLDLGYHIREVTLTGPGTDEQLAEQIS
FT                   GLAARPLSRDRPLWQCYLVNGLTGGRQAIYTKVHPAVIDGLTAAQALAVLMDTTPQPRT
FT                   VPHRFSDEQYQAAGALGMLGNSAWHLALLPARLMWSSLRLAPHLPELADALTVPGADLL
FT                   GTLARGLTPRTWRRPADEATAGAPAPAPAPPDTPFPGPDTARRRFAFTSLPLGEVDAVR
FT                   TALGCTVDDVVTALCTTVLRRWLIDHDAPPNTTLAAAMPIARRTDAQFAAADHRLSLLP
FT                   IALPINEADPARRLHKVHTSLTAAPQRFRAAPATLVRDVGAALPRALRGPISRTPLRAL
FT                   TMPTPPVNLIISHAAGPARPLYTAGIEVTGNFPVSAVSDMTGGITIAAMSYGRHLDVGI
FT                   ITCRNLVPDVWDVTGQLHQALSELTACTRNVRYLRPARPPHRPMSR"
     atgcaccagc tcagttcact cgatgcgcag ttcctcgacg ccgagacatc gaccacctgc        60
     acccatgtcg ggatcctgag cgtcctcggc cccaccacac cgggtggcgg gctcacggtg       120
     caggccctcc gggcgctcgc cgatggccga ttacacctgg tggggccact gcggtggcgg       180
     ctacagcagg tacctctcgg gctcgaccgg ccctactggg tggactccga gttcctcgac       240
     ctcggctatc acatccggga ggtcaccctg accggtcccg gcaccgacga acagctcgcc       300
     gagcagattt ccggtctcgc ggcacgtcca ctgagccgcg accggcccct gtggcagtgc       360
     tacctggtga acgggctcac cggtggccgg caggcgatct acaccaaggt gcaccccgcg       420
     gtgatcgacg gcctgaccgc ggcgcaggct ctcgcggtgc tgatggacac caccccgcaa       480
     ccccgcacgg tgccgcaccg gttcagcgac gagcagtacc aggcggccgg cgccctgggg       540
     atgctcggca acagtgcctg gcatctggcc ctgttgcccg cgcggctgat gtggtcctcg       600
     ctccggctgg caccgcacct gcccgagctc gccgacgctc tcaccgtccc gggcgcggac       660
     ctgctgggca cactcgcccg ggggctgacc ccgcgcacat ggcggcggcc ggccgacgag       720
     gcgacggccg gggcaccggc accggcaccg gcaccgcccg acaccccatt ccccggcccc       780
     gacaccgcgc gccgacgatt cgcgttcacc tcgctgccac tcggcgaggt cgatgcggtc       840
     aggaccgcgc tgggatgcac cgtcgacgac gtggtgacgg cgctgtgcac caccgtgctg       900
     cggcgctggc tcatcgacca cgatgccccg ccaaacacga cgctggccgc ggccatgccg       960
     atcgcacggc gcaccgacgc acagttcgcg gccgccgacc atcgactctc cctcctgccc      1020
     atcgcccttc cgatcaacga agccgacccg gcccgccgcc tgcacaaggt gcacacctca      1080
     ctcacggcgg caccccaacg tttccgcgcc gcacccgcca ccctcgtccg cgacgtcggc      1140
     gccgcgctgc cgcgagcact gcgcggcccg atctcacgca caccgctgcg ggcactgacc      1200
     atgcccacgc caccggtcaa cctgatcatc tcccacgccg ccggccctgc tcggccgctg      1260
     tacaccgcgg gcatcgaggt aaccgggaac ttccccgtct ccgccgtcag cgacatgacc      1320
     ggcggcatca ccatcgccgc catgtcctac ggccggcacc tcgacgtcgg catcatcacc      1380
     tgccgaaacc tcgtccccga tgtgtgggac gtcaccggcc aactacacca ggccctctcc      1440
     gaactgaccg cgtgcacccg caacgtccga tacctgcgcc ccgcccgtcc cccgcaccga      1500
     ccgatgtcga ggtaa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page