(data stored in ACNUC7421 zone)

EMBL: CP000431.PE50

CP000431.PE50        Location/Qualifiers
FT   CDS_pept        56936..57817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00050"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91886"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ0"
FT                   /protein_id="ABG91886.1"
FT                   /translation="MTARHPIVVGTDGSPSSLQAVAWAAQEAALRNSPLSVIATTFVPG
FT                   AYGVPIGMPESFFDDEERNGKNRLAAAAEIAARTVPGQSLDIHTTLCTGTPAGELLERA
FT                   KSAAMVVVGSNRQGIIERGFLGSVSAAVATHAPCPVAIIHDLPDSEVTRLEGPVVVGVD
FT                   GSAHSEPAISMAFAEAGLRQCELVAVHAWSDVDLPVHYEGGSVSGWKQIVTQETALLSE
FT                   SLAGRAEDFPDVKVRTMVVMDRPVRNLREQADNARLLVVGSRGRGGFTSMLLGSTSRAL
FT                   MHSVRCPLLVVR"
     atgaccgccc gccacccgat cgttgtcgga acagacgggt caccgtcctc gctccaggcg        60
     gtggcgtggg ccgcgcagga ggcggcgttg cggaactccc cgctgtcggt gatcgcgacc       120
     acgttcgtgc ccggcgccta cggtgtgccg atcggcatgc cggagagctt cttcgacgac       180
     gaggaacgca acggaaagaa ccggctggct gccgcagcgg agatcgccgc ccggacggtg       240
     cccgggcagt ccctcgatat ccacacgacc ctctgcaccg gaacgccggc cggggaactc       300
     ctcgaaagag cgaaatccgc cgcgatggtc gtcgtcggct cgaaccggca gggaatcatc       360
     gagcgcggct tcctgggatc ggtcagcgcc gcggtcgcca cccacgcacc gtgcccggtg       420
     gcgatcatcc acgatcttcc cgattccgag gtcacccgcc tcgaggggcc tgtcgtcgtg       480
     ggggtggacg gttcggcgca cagcgagccc gccatctcga tggccttcgc cgaggccggc       540
     ctgcgccagt gcgaactggt cgccgtgcac gcctggtccg acgtcgacct ccccgtgcat       600
     tacgagggcg gtagcgtttc cgggtggaag cagatcgtca cccaggagac ggccctgctg       660
     tcggagagtc tcgccggccg tgccgaggat ttccccgacg tcaaggtgcg gacgatggtc       720
     gtcatggacc ggccggtacg caacttgcgc gaacaagccg acaacgcccg acttctcgtg       780
     gtcggtagtc gcggacgcgg cggattcacc agcatgctgt tgggatcgac gagccgggcc       840
     ctgatgcact ccgtccggtg cccgctcctc gtcgttcggt ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page