(data stored in ACNUC7421 zone)

EMBL: CP000431.PE53

CP000431.PE53        Location/Qualifiers
FT   CDS_pept        complement(59344..60093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP7"
FT                   /protein_id="ABG91889.1"
FT                   /translation="MTSTSSDTETTAMVHTQAPVVERLIPEFEGSFTRDAIARTVAGSI
FT                   ADLARVPIADMPELAERVARQRLFTALERHPERSSSGRCEPTPDNRVIVSHRSGGPGPL
FT                   PSVTTRQSNRRGHDGPAAWARCARVRGGGDQTGARDHVARGDRDTRTRRGADLLPGHGA
FT                   PAPARQGPPRRAGRGRLPLSTRRHSAGQSPDGRRSCFDRPCAPIVRAGSHTGRGCVRTR
FT                   TVISGYEHDSHIVVHPRGGTELHRLRR"
     atgaccagca cgagcagtga cacggagacc acggcgatgg tgcacacgca ggcgccggtg        60
     gtggagcggc tgattcccga gttcgagggg agtttcacgc gggatgcgat tgctcggaca       120
     gtggcgggca gtattgcgga tctcgcgagg gtgccgatcg ccgacatgcc ggaattggcc       180
     gaacgggttg cccggcaacg gctcttcacg gcactcgaac ggcaccctga acggtcgtcg       240
     tccggccgtt gtgagcccac accggacaac cgagtgatcg tgtcccaccg atccggagga       300
     ccgggcccgt taccgagcgt caccacacgg caatcgaaca ggagaggcca tgacggacca       360
     gcggcatggg cgcgatgtgc aagggtccgg ggcggcggtg accagaccgg tgcccgcgac       420
     cacgtggccc gtggagatcg agatacacga acccgacgcg gagcagacct gctcccgggc       480
     cacggcgcgc ctgcgcccgc acggcaaggc cctcctcgaa gggcagggag aggccggctg       540
     ccactctcga cacgccgaca cagtgcaggt cagtcgccag atggccgccg ctcgtgcttt       600
     gaccgacctt gcgcaccaat tgttcgagct ggcagccaca caggacgcgg ctgcgtgcgg       660
     acacggactg tgatcagcgg ctatgagcat gattcccaca tcgtcgtcca cccccggggc       720
     ggcaccgaac ttcaccgact acggcggtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page