(data stored in ACNUC7421 zone)

EMBL: CP000431.PE55

CP000431.PE55        Location/Qualifiers
FT   CDS_pept        60843..62357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91891"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP5"
FT                   /protein_id="ABG91891.1"
FT                   /translation="MSATERTQRCSPPQAVGGLEVSGVETHTAYVVMVGDVVFKAKKPI
FT                   RTAFADFGTAERRRAACEREVTLNRRLCPDVYLGVAELTDPAGGPTEALVKMRRMPSDR
FT                   RLARLVGGGGDDTTAQVDAIAAVVARFHAGAEQSAEIDCDATPGAVAARWRANVSEVTS
FT                   YRCDVLPAADVHEVQARALRYLKGRKRLFEYRVREGRIVDGHGDLLADDIFCLADGPRI
FT                   LDCLDFDDHLRHVDCIDDAACLAMDLEYLGREDLGSRFLDRYCAAARDEPPASLQHHYI
FT                   AYRAFVRAKVACLRYTQGSRAAGEDARAHCNLALRQLRAGTVRMALVGGLPGTGKSTLS
FT                   RKLADVTGSVVISSDHVRKELDGLDPHSRQVAGFGEGLYSGTMTDRTYAEVLRRARDHL
FT                   TAGRSVVLDASWTQSMRRERAALVASCTHSDLVELECRAPRAMAIARIGSRPTGDSDAT
FT                   PAVYDAMAASAAAWPSATAVDTDTAAGDSVQTAERIWHSTSGWRDE"
     atgtcggcga ccgagagaac tcagaggtgt tcgccaccgc aggcagtcgg tggactcgag        60
     gtgagcggag tcgagacgca cacggcctat gtcgtcatgg tcggtgatgt cgtcttcaag       120
     gcgaagaagc cgatccggac ggcgttcgcc gacttcggca ccgccgaaag gcgtcgcgcg       180
     gcctgtgagc gtgaagtgac attgaaccgc aggctgtgcc ccgacgtgta tctcggagtc       240
     gccgaattga cggacccagc cggagggccg accgaagcgc tggtcaagat gcgccggatg       300
     ccgtcggacc gacgactggc ccggctggtc ggcgggggcg gcgacgatac caccgcgcag       360
     gtggatgcga tcgccgccgt cgtcgcccga ttccacgccg gggcggagca gtctgcggag       420
     atcgattgtg acgccacgcc cggagcggtg gccgcacggt ggcgagccaa cgtctccgaa       480
     gtgacgagtt accggtgcga tgtcctcccg gcggcggacg tccacgaggt gcaggcgcgg       540
     gccctcaggt atctgaaggg gcggaaacgg ctgttcgagt accgcgttcg ggaaggccgg       600
     atagtcgatg gtcacggcga tcttctggcg gacgacatct tctgcctcgc agacgggccg       660
     cgcattctcg actgcctcga cttcgacgac cacctacgcc acgtcgactg tatcgacgac       720
     gcggcatgcc tcgccatgga tctcgagtac ctgggacgcg aggacctggg atcgcggttt       780
     ctcgatcggt attgcgccgc ggcacgcgat gagccgccgg catcattgca gcatcactac       840
     atcgcctatc gggcgttcgt ccgtgcgaag gtggcctgcc tgcggtacac gcagggttcc       900
     cgcgcggccg gcgaggatgc tcgggcgcac tgcaacctcg cgttgcggca gctgcgcgcg       960
     ggaaccgtgc gaatggcact ggtcggtggg ctgcccggca ccggaaagtc cacgctgtcg      1020
     cgcaagttgg ctgacgtcac cggatccgtc gtcatctcca gcgaccacgt ccgcaaggaa      1080
     ctcgacggcc tcgatccgca ttcccgtcag gtggccggat tcggtgaggg cttgtacagc      1140
     ggcaccatga ccgaccgcac ctacgccgag gtgctgcggc gcgctcgcga ccatctcacg      1200
     gcgggaaggt cggtcgtgct ggatgcgtcg tggacacaat cgatgcgccg ggagcgcgct      1260
     gcgctcgtcg cttcctgcac ccacagcgat ctcgtcgaac tcgagtgcag ggcaccacgc      1320
     gccatggcga tcgcgagaat cgggagccgt ccaaccggcg actcggacgc cacccccgcc      1380
     gtgtacgacg cgatggccgc gagtgccgcg gcgtggccct cggccaccgc ggtcgacacg      1440
     gacacggccg ccggggacag cgtgcagacg gcggagcgga tctggcattc cacgtcgggg      1500
     tggcgagatg agtag                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page