(data stored in ACNUC7421 zone)

EMBL: CP000431.PE57

CP000431.PE57        Location/Qualifiers
FT   CDS_pept        complement(63638..64513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00057"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91893"
FT                   /db_xref="GOA:Q0SKP3"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91893.1"
FT                   /translation="MGTVIDRLDVTRGGWRTRHSALHLAVSAAQTCLERAGRNADDLDL
FT                   LVNVGLYRDRNLGEPALAALIQEDIGAHPEDPHDDTHGTFSFDVANGSCGALNGLQIVD
FT                   GFLRSHTINWALVVASDADPGRGMSEHFPFAPTGGAILCRWTDDEFGLGPVHWVNCSDA
FT                   GESFCATVGLEDSRNVLRFRESDSMDERFATAGAQAARECLEASSLELADVDLIVAAPA
FT                   RPKFRAALAEHLGVPVPRIVVAYDERMHTASLVAALDRRTGGIPAGNRVLIVAVGAGVT
FT                   AGAALYSEHP"
     atgggcacag tcattgatcg gctcgacgtc acacgaggcg gctggcgtac ccgccacagt        60
     gcattgcatc tcgcggtgtc ggccgcccag acctgcctcg aacgggccgg tcggaatgcc       120
     gacgacctgg acctgctcgt caacgtcggg ttgtaccgcg accggaatct gggagagccc       180
     gccctcgcgg cgctcatcca ggaagatatc ggtgcccacc cggaggaccc ccacgacgac       240
     acgcacggga ccttttcctt cgatgtcgca aacggatcct gtggggctct caacggtctg       300
     cagatcgtcg acggattcct gcggtcgcac acgatcaact gggcgctggt ggttgccagt       360
     gatgccgatc ccggacgtgg gatgagcgag cactttccgt ttgcgccgac gggtggagcc       420
     atcctctgcc gctggaccga cgacgaattc ggcctggggc ccgtccattg ggtgaattgc       480
     tccgacgccg gtgaaagctt ctgtgccacc gtcggactcg aggattcccg gaacgtactg       540
     cgattccggg agtcggattc gatggacgag cgattcgcga ccgccggagc gcaggcggcg       600
     agggaatgcc tggaggcatc ctccctcgag ctcgccgatg tcgatctgat cgtggccgct       660
     cccgcccggc cgaagttccg cgcggcgctc gccgagcacc tgggtgtccc cgtgccgcgg       720
     atcgtggtcg cctatgacga acggatgcat accgcgtccc tcgtggcggc cctggaccgc       780
     cggacgggtg gtatcccggc cgggaaccgt gtcctgatcg tcgccgtggg tgcaggggtc       840
     accgccggcg ccgccctgta cagcgaacac ccctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page