(data stored in ACNUC7421 zone)

EMBL: CP000431.PE58

CP000431.PE58        Location/Qualifiers
FT   CDS_pept        complement(64497..65552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00058"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91894"
FT                   /db_xref="GOA:Q0SKP2"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP2"
FT                   /protein_id="ABG91894.1"
FT                   /translation="MPFATRLAGAGRHLPTTHLTTTDLMSTTRHSTHIDLERLTGIRER
FT                   RVSVGDEDSYTLAISAALDCLERSNRDAASIDVVVSCSITKFHGGLTQWLEPTMSSAVA
FT                   QAIGAPGAMTFDLSNACAGMLTGVTVMNNWIRQGIVERALVVSGEYISQLGQNAAQHIR
FT                   NIMSKELACLTLGDAGAALLLERAPAGSAGIGLAGFTTVADYSRLCLAYPKGDDPGARM
FT                   FTNSRGIQRAAIADTPLLLHEVLDAAGISLHDIDHVITHQTSARAIRKGMAEVTATLGD
FT                   SPRHDAVITVDRYGNTASTTHTVALVEELEAGRIRAGETVALIALASGLEIGVVLLTLD
FT                   EELVARYGHSH"
     atgccgttcg ctacgcgtct cgccggggcc ggccggcatc tacccacgac acatctcacg        60
     accacggacc tgatgtcgac cacccgtcac tcgactcaca tcgacctcga gcggctcacc       120
     gggatccgcg agcgccgggt atcggtgggg gacgaagact cctacacact ggcgatctcg       180
     gcggcactgg attgcctgga acggtcgaac cgggacgccg cgtcgatcga tgtagtggtc       240
     agctgcagca tcaccaagtt tcacggcggt ctcacccaat ggctcgaacc gacgatgagt       300
     agtgcggtcg cccaggcgat cggcgcgccg ggggcgatga ccttcgatct ctcgaacgcg       360
     tgcgccggca tgttgaccgg tgtgacggtg atgaacaact ggatccgtca gggaatcgtc       420
     gaacgggcac ttgtcgtcag tggtgagtac atttcgcagc tcggacagaa tgctgcccag       480
     cacatccgga acatcatgag caaggagctt gcgtgcctca cgctcggcga cgccggggcc       540
     gcgctgctcc tcgaacgtgc ccctgccgga tcggccggga tcggtttggc cggattcacc       600
     accgtcgccg actacagtcg gctctgtctc gcgtacccga agggcgacga ccccggcgcc       660
     cgaatgttca ccaactcgcg ggggatccag cgggcggcga tcgcggacac cccgctgttg       720
     ttgcacgagg tgctcgacgc cgccgggatc tccctccacg acatcgatca cgtgatcaca       780
     caccaaacct cggcgcgagc gatccgcaaa gggatggccg aggtgaccgc cacgctgggc       840
     gattctccac ggcacgacgc ggtcatcacc gtcgaccgct atggaaatac ggcctcgacg       900
     acccacaccg tcgcgctggt cgaggaactc gaagcaggcc gcatccgagc gggtgagacc       960
     gtggcgttga tcgccctcgc atcgggtttg gagatcggcg tcgttctgct gaccctggac      1020
     gaggaattgg tggcacgcta tgggcacagt cattga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page