(data stored in ACNUC7421 zone)

EMBL: CP000431.PE59

CP000431.PE59        Location/Qualifiers
FT   CDS_pept        65779..66369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_function:
FT                   GO:0016779 - nucleotidyltransferase activity; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91895"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP1"
FT                   /protein_id="ABG91895.1"
FT                   /translation="MQARHVMSSPVTTVDRSTSVDECLRLVGSSGFTVLPVVDERKHLV
FT                   GIVSEGDLLRARFRELGGADRGTDPQPDEMSAGDVMASPVVAMTADAEVSELASAMLRS
FT                   RLRGIPIVHDHDILGIVTRPDLIAVLTTDDAQVAKEVQHRLDVYGGAGRWRVDVAHGSA
FT                   AIYGVTPQDPERNVIAALADTVPGIAEVHFPPE"
     atgcaggcac gacacgtcat gagcagcccg gtcaccacgg tggaccgatc cacctcggtg        60
     gacgaatgcc ttcggttggt cggaagttcg ggcttcacgg tgcttccggt cgtcgacgag       120
     cggaagcatc tcgtgggcat cgtgtccgag ggtgatctgc tccgtgcacg attccgtgag       180
     ctgggcgggg cggaccgcgg gaccgacccg cagcctgacg agatgtccgc aggcgacgtc       240
     atggccagtc ccgtggtggc gatgacggcc gacgcggagg tcagtgaact cgcatccgcg       300
     atgcttcgat ctcggctgcg cggcatcccc atcgtccacg atcacgacat cctcgggatc       360
     gtcacccgcc ccgatctcat cgccgtcctc acgaccgacg acgctcaggt cgcaaaggaa       420
     gtgcagcacc gcctcgacgt ctacggtgga gccggccgat ggcgcgtaga cgtcgcccac       480
     ggctccgccg cgatctacgg tgtcacgcct caggacccgg aacgaaatgt catcgccgca       540
     ctggccgata ccgtgccggg catcgccgag gtgcatttcc cgcccgagta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page