(data stored in ACNUC7421 zone)

EMBL: CP000431.PE6

CP000431.PE6         Location/Qualifiers
FT   CDS_pept        complement(11208..11435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S094"
FT                   /protein_id="ABG91842.1"
FT                   /translation="MFVRALHTEMMARNAYIHHKKIEGSQLPLMIAVLDEFFILSGKWQ
FT                   RLAKTGDDATREQPESDSRNSTRERRATRE"
     atgttcgtgc gtgcgctgca caccgagatg atggcccgca acgcctacat tcaccacaag        60
     aagatcgagg gctcgcagct accgctgatg atcgcggtcc tcgacgagtt cttcattctc       120
     tccggcaagt ggcagcggct ggcgaagacg ggtgacgacg cgacccgaga gcaacccgag       180
     agcgactcga ggaactcgac ccgagagcgg agagcgaccc gagagtga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page