(data stored in ACNUC7421 zone)

EMBL: CP000431.PE60

CP000431.PE60        Location/Qualifiers
FT   CDS_pept        66421..66678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91896"
FT                   /db_xref="GOA:Q0SKP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP0"
FT                   /protein_id="ABG91896.1"
FT                   /translation="MQARYLDAGDLRWPWVAAAAVVGFAALSMTSPLAVLGGAAAVVFI
FT                   GLGVFRNPHQRVVGAAIVSVGVGLLVPGLPALLLHGVNSL"
     atgcaggcaa ggtatctcga cgccggagat ctgcgatggc catgggtcgc ggccgccgcc        60
     gtcgtgggct tcgccgcatt gtcgatgaca tctcccctcg ccgtcctcgg gggtgcagcc       120
     gcggtcgtct tcatcggact cggcgttttc cgtaatccgc accaacgggt cgtcggcgcc       180
     gcgatcgtgt cggtcggtgt cggactgctg gtgccgggct tgcccgccct gctcctgcac       240
     ggtgtgaact cgctgtga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page