(data stored in ACNUC7421 zone)

EMBL: CP000431.PE61

CP000431.PE61        Location/Qualifiers
FT   CDS_pept        66752..67639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00061"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91897"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN9"
FT                   /protein_id="ABG91897.1"
FT                   /translation="MTTDSPIVVGVDGSAHSLDAVCWAADAAVHHRAPLSSLLGAPGTF
FT                   GDAVNLSAGVFSGVEYAGTQSLATASELARRSVPGNHLTLRTSLRHGSAVAALLDAAES
FT                   ARMLVVGSRGLGEFTGGLVGSVSAAVASHAPCPVAVIRGMPEMDAPPLDGPVVVGVDGS
FT                   PNSEPAIAAAFEEASLRGVDLVAVHAWSDFSLLTVTPADPSDNELPWSAIETAERAVLS
FT                   ERLAGWKDKYPDVSVRKVVVRDRPVHHLLQQARESQLVVTGSRGRGGFASLLLGSTSRA
FT                   LLHALTCPLLIVRR"
     atgacaacag attcaccgat cgtcgtgggt gtggacggat cggcgcactc actcgacgcc        60
     gtgtgctggg ccgccgacgc ggccgtccac catcgagccc cgttgtcctc cctcctcggt       120
     gcgcccggta cgttcggcga cgccgtcaac ctctccgcag gcgtgttcag cggcgtggaa       180
     tatgcgggca cccagagtct cgccacggct tcggaactcg cccggcggag cgtgcccggc       240
     aaccacctca ccctccggac gtcgctgcgt cacggctcgg ccgtggcggc cctgctcgac       300
     gccgccgagt cggcgcgcat gctggtcgtc ggttcccgtg gcctcggaga gttcaccggc       360
     ggcctggtcg ggtcggtcag cgccgcggtt gccagtcatg caccctgccc ggtggcggtg       420
     attcgcggaa tgccagaaat ggacgcgccg ccgttggacg gcccggtggt ggtcggagtc       480
     gatggttcac cgaacagcga acctgccatc gcggccgcct tcgaggaggc ctctctgcgc       540
     ggcgtcgacc tcgtggcagt gcacgcgtgg agcgacttca gcctgttgac cgttaccccc       600
     gccgatccca gcgacaacga acttccctgg tcggcaatcg aaaccgctga acgggcggtc       660
     ctgtcggaga gacttgccgg atggaaggac aaatatccgg acgtgtccgt ccgcaaagtt       720
     gtcgtccgag atcgaccggt tcaccacctg ctccagcaag cgcgggaatc gcagttggtg       780
     gtgaccggca gccgggggcg tggtgggttc gcctcactgt tgctcggttc gacgagccgg       840
     gctctcctcc acgcgctgac ctgcccgctg ctgatcgttc gccggtga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page