(data stored in ACNUC7421 zone)

EMBL: CP000431.PE62

CP000431.PE62        Location/Qualifiers
FT   CDS_pept        67975..68571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00062"
FT                   /product="possible potassium channel protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91898"
FT                   /db_xref="GOA:Q0SKN8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN8"
FT                   /protein_id="ABG91898.1"
FT                   /translation="MDRHISRMTGHAIVCGFGRVGRAGVQYLATLGMPVVVVDRDPERL
FT                   AELDVPTVVGDVTDDQVLEAAGIGHAHALIRAGANRVVTLISSGAPDGCLRAPATRRRV
FT                   LARRDARRDAGLPDRGGRGLACLAAGRANTGGSGPRGATGSLLMALWSPTGQFVADPTP
FT                   EQRLDPGTILIALGTAPQLDALRREVRQSEGIYSP"
     atggacagac acatcagcag gatgaccggg cacgcgatcg tctgtggttt cggccgggtc        60
     ggacgggccg gagtgcagta tctggccacg ctcgggatgc cggtcgtcgt cgtcgatcgc       120
     gatccggagc gcctcgccga gctcgacgtc ccgacagtcg tcggggatgt caccgacgat       180
     caagttctcg aagcggcggg aatcggccat gcccacgctc tgatccgggc gggagcaaac       240
     cgcgtcgtca ccctcatctc atcgggggcg ccggatgggt gccttcgcgc tccagccaca       300
     cgtcgccgag ttctcgcacg tcgtgatgca cgacgagacg ctggattacc ggatcgagga       360
     ggtcgaggtc tcgcctgcct cgccgctggc cgggcgaaca ctggcggaag cgggcctcgc       420
     ggcgcaaccg gctcactgtt gatggcgttg tggtcaccga cggggcagtt cgtcgccgat       480
     cccaccccgg agcaacgtct ggacccgggc accattctca ttgcactcgg aactgcgccg       540
     caactcgatg cgcttcggcg cgaggtcagg cagagtgagg gaatctactc accctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page