(data stored in ACNUC7421 zone)

EMBL: CP000431.PE63

CP000431.PE63        Location/Qualifiers
FT   CDS_pept        complement(68585..68827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91899"
FT                   /db_xref="GOA:Q0SKN7"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN7"
FT                   /protein_id="ABG91899.1"
FT                   /translation="MSPWKRPVTWSRLTASQRAALVVMAAVQVGLAVAAWADLAKRDPH
FT                   EIRGSRTTWAAAIAVNFIGPIAYFRWARRAPAQAR"
     atgagtccat ggaagaggcc tgtgacgtgg tcgcgtctga cagcgtcgca gcgcgccgcg        60
     ctggtggtga tggcggcggt gcaggtgggg ctggccgtgg cggcctgggc agatctcgcg       120
     aaacgtgatc cacacgagat cagggggagc agaacgacat gggctgctgc gattgccgtg       180
     aacttcatcg gaccgatcgc gtacttccgg tgggcccgcc gtgccccggc gcaggctcgg       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page