(data stored in ACNUC7421 zone)

EMBL: CP000431.PE64

CP000431.PE64        Location/Qualifiers
FT   CDS_pept        complement(68903..69748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91900"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN6"
FT                   /protein_id="ABG91900.1"
FT                   /translation="MTVLVAYATAKGSTRGIAERLGSCIEGLGQSVDVRPVAAVSDVHS
FT                   YDVIVFGSAIHNGQWLAEASDAVGRLRSQFEGRRVWAFSVSSVGVTSTTLSKRLARFLR
FT                   RVTPEPGAVRILRDAADVRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCA
FT                   WAGAIAAESTRDTERRRVWAFSVSSVGVTSTTLSKRLARFLRRVTPEPGAVRILRDAAD
FT                   VRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCAWAGAIAAESTRDTERWT
FT                   "
     atgacggtac tggtggcgta cgcgacggcg aaaggctcga cccgcgggat cgcggagcgg        60
     ctcggatcgt gcatcgaagg cctcgggcag tcggtcgacg tccggccggt cgcagccgtg       120
     tctgacgtgc actcctacga cgtgatcgtt ttcggaagcg cgatccacaa cggacagtgg       180
     ctcgccgagg cctccgacgc cgtcgggcgc ctgcggtccc agttcgaggg aaggcgcgta       240
     tgggcgttct cggtgtcgtc ggtcggcgtc accagcacca ccctgtcgaa acgactggcg       300
     cgttttctgc gtcgcgtgac accggagccc ggagcagtgc ggatactgcg ggatgcggcc       360
     gatgtgcgcg accaccgatt cttcgccggc gtgatcgcac cgggcgactg gccgggattc       420
     gggcgagtcg tcttcacgct catgggtggg cactacggcg acgcccgcga ctgggcggac       480
     gtgtgcgcgt gggcaggcgc catcgccgcc gaatcgaccc gggacacgga aagaaggcgc       540
     gtatgggcgt tctcggtgtc gtcggtcggc gtcaccagca ccaccctgtc gaaacgactg       600
     gcgcgttttc tgcgtcgcgt gacaccggag cccggagcag tgcggatact gcgggatgcg       660
     gccgatgtgc gcgaccaccg attcttcgcc ggcgtgatcg caccgggcga ctggccggga       720
     ttcgggcgag tcgtcttcac gctcatgggt gggcactacg gcgacgcccg cgactgggcg       780
     gacgtgtgcg cgtgggcagg cgccatcgcc gccgaatcga cccgggacac ggaaagatgg       840
     acctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page