(data stored in ACNUC7421 zone)

EMBL: CP000431.PE65

CP000431.PE65        Location/Qualifiers
FT   CDS_pept        complement(69745..71229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00065"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91901"
FT                   /db_xref="GOA:Q0SKN5"
FT                   /db_xref="InterPro:IPR025498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN5"
FT                   /protein_id="ABG91901.1"
FT                   /translation="MRTGRVAVLVLGCLSALTGFALLTAAVFLGWAYFMQRDGGHFTSP
FT                   REHFETSESALVSEKVDLFEGADLPKGFSTEDLGRVLVRATATDPDQEIFIGIGPRDEV
FT                   DKYFTDVARTEVTDVQFDPFRPTYRQIPGTRPAALPGTQPFWSASSSGTGTQEVRWELQ
FT                   QGSWTAVVMKADATPGLSVDIQAGARLTFLGPLALSVLVGAVVLLIIGIPLIVAGAIGL
FT                   GRHGPPQPHPVAQIAGDGTIAGDAHVPWTVYPARLVGELDAPLSRWLWLVKWLLALPHY
FT                   FVLFFLGIAFVVTTLVSGFAILFTARYPRTLFDFNVGVLRWVWRVQFYTYSALATDRYP
FT                   PFTLNRTDYPADFDVDYPVRLSRGLVLVKWWLLAIPHYLILALLAGGWFGSWRAGVTVT
FT                   DGTHYGQPWLLGSVLGLAVTFSAIALLFTGRYPHGLFDFVMGINRWAFRVAAYATLMRD
FT                   EYPPFRLDQGPCEPHEPTPHSGGDDSGETSPERPRT"
     gtgcgaaccg gcagagtagc cgttctcgtc ctgggctgtc tgagcgccct gaccgggttc        60
     gcgctgctca ctgccgcggt gtttctgggg tgggcctact tcatgcaacg cgacggtggg       120
     cacttcacct cgccgcgtga gcacttcgag acgagtgaga gtgccctggt atcggagaag       180
     gtcgatctct tcgagggcgc ggacttgccg aaaggcttca gcaccgagga cctcggccgg       240
     gtactggtgc gagccaccgc caccgatccc gaccaagaga tcttcatcgg gatcggccct       300
     cgtgacgagg tcgacaagta cttcaccgac gttgctcgca ccgaagtgac agacgtgcag       360
     ttcgatccgt ttcggccgac ctatcggcag attcctggaa cccgaccggc agcattacct       420
     gggacacaac cattctggtc cgcctcttcc tcgggtactg gcacgcagga agtgcggtgg       480
     gagctacagc aggggtcctg gacggctgtc gtcatgaagg cagacgcaac tccaggcctg       540
     tccgtcgaca ttcaggccgg cgcacgcctc actttcctcg gaccactcgc actgagcgtc       600
     ctggtcggcg cggtcgtcct tctgatcatc ggaatcccgt tgatcgtggc aggagcaatc       660
     gggttgggcc ggcacggccc gccacaaccg catcccgtcg cgcagatcgc gggcgacggc       720
     acgatcgccg gcgacgcaca cgttccatgg accgtctatc ccgctcgcct cgtgggtgaa       780
     ctcgacgcgc cgctgtcgcg atggctgtgg ctggtgaaat ggctcctggc gctcccgcac       840
     tacttcgtgc tcttcttcct cggaatcgcg ttcgtcgtca ccaccctggt gtccggattc       900
     gcgatcctgt tcaccgcgcg gtatccgcga accctgttcg acttcaacgt cggagttctc       960
     cggtgggtgt ggcgagtgca gttctacacc tactcggccc tggccacgga ccgctacccg      1020
     cccttcaccc tgaaccgtac cgactatccc gcggacttcg acgtcgacta ccccgtgcgg      1080
     ttgtcccgcg gactggtcct cgtgaagtgg tggctgttgg cgatcccgca ctacctgatc      1140
     ctggcgctac tcgcgggagg gtggttcggg agctggcgtg ccggagtgac cgtcaccgac      1200
     ggtacgcact acgggcagcc gtggctcctc ggttctgtgc tcggtctcgc ggtgactttc      1260
     tcggcgattg cgcttctctt caccgggcga tacccacacg gtttgttcga cttcgtgatg      1320
     ggaatcaatc gttgggcgtt ccgcgtcgcg gcgtacgcga ccctgatgcg ggatgaatac      1380
     ccaccgttcc gtctcgatca gggaccatgc gagccgcacg agcccacgcc gcactcgggc      1440
     ggagacgatt ccggcgagac ctctccggaa aggccacgca catga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page