(data stored in ACNUC7421 zone)

EMBL: CP000431.PE7

CP000431.PE7         Location/Qualifiers
FT   CDS_pept        12456..12710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU3"
FT                   /protein_id="ABG91843.1"
FT                   /translation="MPSTAGSSRGAYTAAAAPATAIGEVGVKRPMRARSGGRIDLRACA
FT                   CGVAVAEDLAVLLNHPVLDRVTTCVHRGLLSLGPTPLRE"
     ttgccgtcga cggccggcag cagccgtggc gcgtacaccg ccgcggcggc gccggccaca        60
     gcgatcggtg aggtgggggt gaagcggccg atgcgcgccc ggtcgggcgg ccgaatcgac       120
     ctgcgtgcct gcgcgtgcgg tgtcgcagtc gccgaagatc tcgcggtact gctgaaccac       180
     ccagtcctcg accgggtcac gacgtgcgtt caccgcgggc tcctttcgct cggcccgaca       240
     ccactgcggg agtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page