(data stored in ACNUC7421 zone)

EMBL: CP000431.PE70

CP000431.PE70        Location/Qualifiers
FT   CDS_pept        complement(74280..74984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91906"
FT                   /db_xref="GOA:Q0SKN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91906.1"
FT                   /translation="MAETQRAQEFRRLRTPRSAAVAGIVFAVLFAASLVLLRTALPADP
FT                   FDETPWVGSGETRIKTALLLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFVSMGVAGGVLAIARHSGSSANDIVYFGREIMLQINHVYALRMAAVFMISLGTIWL
FT                   RTGLMPRWLVMTTYLLALALLAIVDFSLWSTLAFPAWVLLISVYILVTGRRASAADRSF
FT                   RSAPVSWRRSRR"
     atggccgaaa cgcagcgcgc gcaggagttc cgccggctga ggacgccacg ctcggcggcc        60
     gtcgcgggaa tcgtcttcgc cgtgctgttc gccgccagcc tcgtccttct gcggaccgcg       120
     ctgccggcgg acccgttcga cgaaaccccc tgggtgggca gcggcgagac gcggatcaag       180
     acggccctgc tcctcgctcc gttcgcgggg atcgccttcc tctggttcat cggcgtcatc       240
     cgcgaccgtc tcggcgacct cgaggaccgg ttcttcgcga cggtgttcct cggcagcgga       300
     ttgctgtttc tcgcgatggg attcgtctcg atgggggtgg cgggcggcgt gctcgccatc       360
     gcccgccact cgggcagctc cgcgaacgac atcgtctatt tcggccgcga gatcatgctg       420
     cagatcaacc acgtctacgc gctgcgcatg gccgcggtgt tcatgatctc gctggggacg       480
     atctggctgc ggaccggcct gatgccgcga tggctcgtca tgaccacgta tctgctggcc       540
     ctggcgctgc tggcgatcgt cgacttcagc ctgtggtcga cgttggcgtt cccggcatgg       600
     gtgctgctga tcagcgtcta catcctcgtc accgggcgcc gcgcgagcgc agccgaccga       660
     tcattcaggt ccgcgccggt gtcgtggaga cgaagtcgtc gatga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page