(data stored in ACNUC7421 zone)

EMBL: CP000431.PE71

CP000431.PE71        Location/Qualifiers
FT   CDS_pept        75236..76717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00071"
FT                   /product="multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0008199 - ferric iron binding; GO_process:
FT                   GO:0006725 - aromatic compound metabolism; GO_process:
FT                   GO:0006810 - transport; GO_process: GO:0046677 - response
FT                   to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91907"
FT                   /db_xref="GOA:Q0SKM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM9"
FT                   /protein_id="ABG91907.1"
FT                   /translation="MMVTHATTERWTPRLIFSLASIVLLLEMLAVSYMMISIALPQIVT
FT                   HYQTTQGAWLLTAFLLVGAITCPLIGKLADTHGKRRLLLTAVGLSALGSLISAIAPTYA
FT                   VLIAGRALTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGMGLIAIPAPFFTGWLID
FT                   NFGFRSIFWFFVAGLVILAVLIRATTGESTVRLRSRIDLIGAALLGAGLAGILVGVSFG
FT                   PSWGWTSGATIGFLAGGAALLVAWMVSARLLADPLIDIRFFGKRPVFLTALGAGFCYGT
FT                   SAVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGGAVVIGGLIVGTLVPRNVRP
FT                   RILMVVGMLVMAAACLLTAMVHDDKALLIGFAALLGVGMGMGYASVPNLLIAAVPPQLQ
FT                   ATTASMVAVFQSILPAILPVIVFSVLNSHIATVVQGAVFYTDTGITIAFVIGAVSALLG
FT                   AVVAFALPRRISQLSAPGSGAAAAADTDGAVVLAH"
     atgatggtca cccatgcgac taccgagcga tggacaccgc gcctgatctt ctcgctcgcc        60
     tcgatcgtgt tgctgctgga gatgctcgcg gtcagctaca tgatgatctc gatcgcgttg       120
     ccgcagatcg tcacccacta ccagacgacg cagggcgcat ggttgctcac ggcgttcctg       180
     ctggtgggag cgatcacctg cccgctgatc ggcaagctcg ccgataccca cggcaaacgg       240
     agactcctgc tgacggccgt gggcctgtcg gcgctcgggt cgctgatctc ggcgatcgca       300
     ccgacatacg cggtgctgat cgccggccgc gccctcaccg gtctgctcgt gccctgcctg       360
     ttcctgagct attcgctcat ccgcgacgtc ttccccgccc ggacggtggc gttggcggtc       420
     agcatcgcca cgagcggcat gggcctcatc gcgatccccg caccgttctt caccgggtgg       480
     ctgatcgaca atttcggctt ccggagcatc ttctggttct tcgtggccgg tctggtgatc       540
     ctcgccgtcc tgatccgggc gacgaccggc gaatcgaccg tgcggctgcg ctcccgcatc       600
     gacctgatcg gcgcggcgct cctgggcgcc ggactcgccg gcatcctcgt cggggtgagc       660
     ttcgggccct cgtggggctg gacgtcgggg gcgacgatcg gtttcctcgc cggcggtgcc       720
     gccctgctgg tggcgtggat ggtgtccgca cgactgctcg cggacccgct gatcgacatc       780
     cggttcttcg gtaagcggcc ggtgttcctg acggcgctcg gcgcgggatt ctgctacggc       840
     acgtccgcgg tgttcacgat catgctcccg atgatgtgca tgaccccggc gatcctgggg       900
     ctcggctacg gattcggtat cagcgcagag ggattcgcga tcttccaggc gccgctcggt       960
     ggcgccgtgg tgatcggcgg actgatcgtc ggaaccctgg tcccccggaa cgtccgtccg      1020
     cggatcctga tggtcgtggg catgctcgtg atggccgccg cctgcctgct cacggcgatg      1080
     gtccacgacg acaaggccct cctgatcggc ttcgccgcac tcctcggcgt gggaatgggc      1140
     atggggtacg cctccgtccc gaacctgctc atcgccgcgg tgccgccgca gttgcaggcg      1200
     acgacggcga gcatggtggc ggtgttccag agcatcctgc ccgccatcct cccggtgatc      1260
     gtcttctccg tgttgaactc gcacatcgcg accgtcgtgc agggtgcggt cttctacacc      1320
     gacaccggca tcaccatcgc gttcgtgatc ggcgcggtct cggcgctgct gggcgcggtc      1380
     gtggccttcg cgttgccccg ccggatttcg caactgagcg cacccggttc gggggccgcg      1440
     gccgcggccg acacggacgg ggccgtcgtc ctcgcccact ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page