(data stored in ACNUC7421 zone)

EMBL: CP000431.PE72

CP000431.PE72        Location/Qualifiers
FT   CDS_pept        76857..81278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00072"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.11"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0016874 - ligase
FT                   activity; GO_function: GO:0048037 - cofactor binding;
FT                   GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91908"
FT                   /db_xref="GOA:Q0SKM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM8"
FT                   /protein_id="ABG91908.1"
FT                   /translation="MRVRIPGRVVPLTEAQHAIWFAQQLAPEIPYVIAQYVDLRGPVRL
FT                   DLLTEASARAVHELGSFTVREVDGRPHQVFGAGTSERVPVVDLRDEHDPVDAAERWMRK
FT                   DCIAPVDMYGESLVLSTILQVGDERTYWYTRAHHVAMDGYAAMMLMRRTAELYVAGIDG
FT                   DRPPEFRAVDPGRIAADDAGYRSSPRFQRDRAYWREQVRDLPPTVGLSGRRTPNPGASV
FT                   LVARGSADRSSDLLRPTGDGNAHSPTVVVVAAFAAYLARMTGADDVILSLPVSARTSAR
FT                   LRGTGGSVSNVLPLPLRGVGTGTVRDAVRAARTALTGALRHQRYRREDIGKDIASAGTG
FT                   LTHFGPVLNLMLFKQEITLGAVTGRVQVLTTGPTADLAVNIYPGPPGSVPRIDVEANPA
FT                   LYDEDEVTGHHRRFTMFLARFQAAAGTDRSVAELDVFHDAEREAFSPACGRPDSEPAPL
FT                   DRILAATVVTRPDAVAVRDRGRVVTYRELDEAADRWARVLTGHGVGPEDLVAVSIPRSY
FT                   ESVLALWAVARTGAAYVPVDPTHPTDRIAYTLGDSGAALGLTVRSARDRLPTTIRWLSI
FT                   DDGDDHPPTVERDRPVHLGHPAYVIYTSGSTGVPKGAVVTHDGLANLVQEIREKYAVAA
FT                   DSRVLHFASPSFDTALVEVLAACIGGATLVIAPTDVYGGAELRELLRAERITHLLSTPS
FT                   ALATVDPDGLDSLELVLVGGEVCPQDLADRWAVGRTMRNAYGPTETTCSVTLTDPLDPG
FT                   GRVTIGSLMRGVRATVCDPLLRPLPPGAVGELYLATPALARGYHRRPALTATRFVADPS
FT                   GKPGSRMFRTGDRVRWTNSATLEFLERTDDQVKVRGFRIELGEIDAALRRNPDIDFATT
FT                   IVHRTPVGDPVLVSYIMVRRESQTTPESARHAIARFLPEYMVPGSITVLDAVPLTPTKK
FT                   LDRGALPAPDFGTTTVPRRDPETTTERTVADVFGRLLGVPAVAAGDSFFDLGGDSLSAT
FT                   RVVATLNAELDATLGVRELFETPTVSALAERIDDRDASRSGAVRAPRIAATAVPDRVPL
FT                   SPSQQFIDRSATTPPLYSIPFTVRVAGAVDVDALRSAVADVLARHGALRTVFPDSAAGP
FT                   YQRLLSVDDALPDLAPIPAGPDDVADRVDRVLGAPFDVRTEPPLRATLFALDARDHLLA
FT                   CVLHHITADGWSLALVARDLVTAYASRTAGAPPGWEPPRVTYPQYSVWRRDMLGAEDDP
FT                   GSVASQQLAYWTEELSGLPGAVGLPLDRRRPHHWTYGAGRATFRIDHTAHHTLASLAHR
FT                   HHATVFTALRSAVAILLARLSGDTDIAVGTPVAGRNDPELDDVVGMFVNTVVLRTRVDP
FT                   GDTLADVIRDSHDIELRAFAHADVQFERLVEVIDPPRSSSLHPFFQVALSLNNFTPATL
FT                   DVAGLRFDITPRPLDVAKCDLHFHFTERHDTTGRPAGIDAELVYATDLFDGATATSFVD
FT                   ALLAVIGGDPGA"
     atgcgggtgc gaatacccgg gcgggtcgtc ccgctgaccg aggcgcagca cgctatttgg        60
     ttcgcacagc agctcgcacc cgagattccc tacgtgatcg cccagtacgt ggacctgcgt       120
     ggtccggtac gcctggacct gctgacggag gcgtccgcac gagccgtcca cgaactggga       180
     tcgttcaccg tgcgggaggt ggatggtcgg ccccaccagg ttttcggcgc cggaacgtcg       240
     gagcgggtgc cggtggtcga tctgcgggac gaacacgatc cggtcgatgc ggccgagcgg       300
     tggatgcgga aggactgcat cgcccccgtc gacatgtacg gcgagtcact cgtcctgtcg       360
     acgattctgc aggtgggcga cgagcgcacc tactggtaca cgcgtgccca ccacgtcgca       420
     atggacggct atgcggcgat gatgctgatg cgccgcaccg ccgaactgta cgtggcggga       480
     atcgacggcg accggcctcc ggaattccgg gcggtcgatc cgggacggat cgcggcggac       540
     gacgccggct accggtcttc gccccgcttc caacgcgacc gcgcctactg gcgggagcag       600
     gtccgcgacc tgccgccgac ggtcggcctc agcggacgac gtaccccgaa tcccggcgcc       660
     tcggtgctgg tggcacgggg cagcgcggac cgcagcagcg acctcttgcg tcccaccggc       720
     gacgggaacg cgcacagccc gacggtggtg gtggtggcgg cgttcgccgc gtatctcgcc       780
     cgcatgaccg gcgccgacga cgtgatcctg tcacttccgg tgtccgccag gacgtctgcg       840
     cgtctgcgcg gcaccggtgg ttccgtgtcg aacgtcctcc cactcccctt gcgcggtgtc       900
     ggcaccggca cggtgcggga cgcggtgcgg gcggcccgaa cggccttgac gggggcactg       960
     cgtcatcagc ggtaccgccg cgaggacatc ggtaaggaca tcgcctctgc cggaacgggt      1020
     ctcacccact tcggtccggt cctcaacctg atgctgttca agcaggagat cactctcggt      1080
     gcggtcaccg gacgcgtgca ggtgctgacg accggtccga cggccgactt ggcggtcaac      1140
     atctatccgg gaccacccgg ctcggttccg cgcatcgacg tcgaggcgaa cccggcgctg      1200
     tacgacgagg acgaggtcac cgggcaccat cgacggttca ccatgtttct cgcacgcttc      1260
     caggccgccg ccggaacgga ccgctcggtc gccgaactcg acgtgttcca cgatgccgaa      1320
     cgggaggcgt tttctcccgc ctgcggacgg ccggattcgg aaccggcacc gttggatcgg      1380
     atcctcgccg cgaccgtcgt cacccgcccg gacgccgtcg cggtgcggga tcgaggacgg      1440
     gtggtgacgt accgcgaact cgacgaggcc gccgaccggt gggcgcgggt gctgacaggt      1500
     cacggcgtcg gacccgagga cctggtggcg gtgtcgattc cgcggtcgta cgaatcggtg      1560
     ctggccttgt gggcggtggc caggaccggc gcggcgtatg tgcccgtcga tccgacccac      1620
     cccaccgacc ggatcgcgta caccctcggc gactccggtg cggcgctggg tctcaccgtc      1680
     cgctctgcgc gcgatcgtct tcccaccacc atccgctggc tgagcatcga cgacggtgac      1740
     gaccatccgc cgaccgtgga acgcgaccgt cccgtgcatc tcgggcaccc ggcctacgtg      1800
     atctacacct ccggctccac cggggttccg aaaggggccg tggtcacaca cgacggtctc      1860
     gccaacctcg tgcaggagat tcgggagaag tacgcggtcg cagcggattc gcgggtgctg      1920
     catttcgcgt cgcccagctt cgacaccgca ctggtcgagg tgctcgcggc gtgcatcggc      1980
     ggcgccaccc tggtgatcgc gccgaccgac gtgtacggcg gggctgaact gcgagaactg      2040
     ctgcgcgccg aacgcatcac ccatctgctg tcgacgccgt ctgcgttggc gaccgtggac      2100
     cccgacggac tcgactccct ggaactggtc ctcgtcggag gcgaggtgtg cccgcaggac      2160
     ctcgcggatc ggtgggcggt cggccggacg atgcggaatg cgtacggacc caccgaaacc      2220
     acgtgcagcg tcaccctcac cgaccccctc gacccgggcg gacgggtgac gatcgggtcc      2280
     ctgatgcgcg gtgtgcgggc gacggtctgc gatcccctgc tacgccccct cccaccggga      2340
     gctgtcggcg agctgtacct cgcgacgccg gccctcgccc gcggatacca ccgacgaccg      2400
     gcattgaccg ccacacggtt cgtcgcggac ccgtccggta agccgggctc ccgcatgttc      2460
     cgcaccggtg atcgggtccg gtggacgaac tcggccaccc tcgagttcct cgaacgcacc      2520
     gacgatcagg tgaaggtccg cggattccgc atcgagctcg gcgagatcga tgccgcgctg      2580
     cgcaggaacc cggacatcga cttcgccacc acgatcgtgc accgcactcc ggtcggagac      2640
     ccggtcctgg tctcctacat catggtgcgg cgcgagtcgc agaccacgcc cgagtcggcg      2700
     agacacgcca tcgcacggtt cctgccggag tacatggttc cgggatcgat cacggtgctg      2760
     gacgcggttc ccctgacacc gacgaagaag ctggaccgcg gcgcgctccc cgcccccgac      2820
     ttcggcacga cgaccgtccc tcggcgcgat ccggaaacga cgaccgagcg cacggtcgcc      2880
     gacgtgttcg gccgactgct cggtgttccc gccgtcgcgg cgggcgattc gttcttcgac      2940
     ctcggcggag actccctgtc ggccacgagg gtggtcgcga cattgaacgc cgaactcgac      3000
     gcgacgctcg gtgtgcgtga gctgttcgag accccgaccg tgtcggcgct cgcggagcgg      3060
     atcgacgacc gggacgcttc ccgatccggc gcggtgcggg ccccgcgcat cgccgccacc      3120
     gccgtgcccg accgggtgcc gctgtcgccg tcgcagcagt tcatcgaccg cagtgccacc      3180
     accccgccgc tgtacagcat tccgttcacg gtgcgggtgg cgggggcagt ggacgtcgac      3240
     gcgctgcgct ccgcagtcgc ggacgtcctg gcgcgccacg gtgcgttgcg caccgtgttt      3300
     ccggactcgg cggcggggcc gtaccagcgt ctgctgtccg tcgacgatgc cctaccggat      3360
     ctggcgccga tccccgccgg acccgacgac gtcgccgacc gggtggaccg ggtgctcggg      3420
     gcgccgttcg atgtgcggac cgaaccccct ttgcgcgcaa cgctcttcgc gctggacgcg      3480
     cgcgatcacc tcctcgcgtg tgtcctccac cacatcaccg cggacggatg gtcgctggcg      3540
     ctggtcgccc gcgatctcgt caccgcgtat gcgagccgga ccgcgggtgc gcccccgggc      3600
     tgggagccgc cccgggtgac gtacccgcag tacagtgtgt ggcgccgcga catgctgggc      3660
     gccgaggacg atccgggaag cgtcgcgtcg cagcaactcg cgtactggac cgaggaactg      3720
     tcggggctac ccggcgcggt ggggttgccc ctcgaccgcc gccggccaca ccactggacc      3780
     tacggcgccg gccgcgccac gttccggatc gaccacaccg cgcatcacac gctcgcgtcg      3840
     ctcgcacacc ggcatcacgc cacggtgttc accgcactga gatctgcggt cgcgatcctg      3900
     ctcgcccgac tgagcgggga caccgacatc gccgtcggca ccccggtcgc cggtcggaac      3960
     gaccctgaac tggacgacgt cgtcgggatg ttcgtcaaca ccgtcgtcct gcggacccgg      4020
     gtcgatcccg gggacacgct ggcggacgtg atccgcgact cccatgacat cgaactgcgt      4080
     gccttcgcgc atgcggatgt gcaattcgag cgactcgtcg aggtgatcga cccgccccgg      4140
     tcgtcgtcac tgcacccgtt cttccaggtc gcgctgtcgc tgaacaactt caccccggcg      4200
     accctggacg tcgccggcct gcgcttcgac atcaccccgc gtcccctcga cgtggcgaaa      4260
     tgcgatctcc actttcattt caccgaacgg cacgacacca ccggccggcc ggcgggaatc      4320
     gacgccgaac tggtgtacgc caccgacctc ttcgacgggg ccaccgcaac gtccttcgtc      4380
     gacgccctgc tggcggtcat cggaggcgat cccggtgcgt ga                         4422
//

If you have problems or comments...

PBIL Back to PBIL home page