(data stored in ACNUC7421 zone)

EMBL: CP000431.PE73

CP000431.PE73        Location/Qualifiers
FT   CDS_pept        81330..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00073"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0000155 - two-component sensor activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0000160 -
FT                   two-component signal transduction system (phosphorelay);
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91909"
FT                   /db_xref="GOA:Q0SKM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM7"
FT                   /protein_id="ABG91909.1"
FT                   /translation="MRARSAAAAALVVTICLVLAGGALLLVLYRTLEHSARDAADARAR
FT                   QIVEQLRTTAPGGLDSSLFATDGQVGTIQVIDSAGTVVATSPGADRLPVTFEPVPPGES
FT                   RYLGNIDLGDEPDYWIVERGAQSPQGPATVVVGADREPIEGILGTVALLMAIGGPVVVA
FT                   MVAVASYRLVGAALLPVERIRARVAAISTDRLDERVPVPHTQDEIARLAETMNSMLGRL
FT                   ESGHRAQQRFVSDASHELRSPLATITAALELAHTRPELVDTSLVDESLLPEARRMNHLL
FT                   ADLLLLARADENGLTHTSVDVDIDDLMYAESARVRDMSPELVVRTAIAPVRVVGDPQQL
FT                   ARVVRNLVDNARRHARREIRLNCRTSSDGAVLEVADDGPGIAVPDRQRIFERFVRLDTP
FT                   RTRDSGGAGLGLAIVAEIVATHGGTIDVTDSGTGGARFVITLPADGTRQSSPDFSR"
     gtgcgcgccc ggtccgcggc ggccgccgcc ctggtggtca ccatctgcct cgtcctcgcg        60
     ggcggagcat tactgctggt gctgtaccgg acactggagc actcggcgcg cgacgccgcg       120
     gacgcccgcg cccggcaaat cgtcgagcaa ctccggacca cggcacccgg gggcctcgac       180
     agctcgctgt tcgcgaccga cggccaggtc ggcaccatcc aggtcatcga ctcggccggc       240
     accgtcgtag ccacctcccc cggcgccgac cgtctccctg tcacgttcga gccggtgccg       300
     cccggcgaat cccggtacct cggcaacatc gacctgggcg acgaacccga ctactggatc       360
     gtcgaacggg gcgcgcagtc accgcagggt cccgcgaccg tggtggtggg ggcggaccgc       420
     gaacccatcg agggcatcct cggcaccgtg gccctcctga tggcgatcgg tggccccgtc       480
     gtggtcgcga tggtggcggt ggcgagctac cgtctcgtcg gcgcggcgct gctgcccgtc       540
     gaacgaatcc gggcgcgggt ggccgccatc tccaccgacc gactcgatga acgcgtcccg       600
     gtgccgcaca ctcaggacga gatcgcgcgg ctcgccgaaa cgatgaacag catgctcggc       660
     cgtctcgagt ccggtcaccg cgcgcagcaa cgattcgtct ccgacgcgtc acacgaactg       720
     cggagtccgc tcgccacgat cacggccgct ctggagttgg cgcacacccg gcccgaactg       780
     gtcgacacgt cgctggtcga cgagtcgttg ctaccggagg cgcgccgcat gaaccatctc       840
     ctcgcggacc tgctgctcct cgcccgggcc gacgagaacg ggctcaccca cacatcggtg       900
     gacgtggaca tcgacgacct gatgtacgcc gagagtgccc gcgtgcgcga catgtcgccg       960
     gagttggtgg tgcggacggc gatcgcgccg gtccgcgtgg tcggcgaccc gcagcaactg      1020
     gcgcgggtgg tgcgcaatct cgtcgacaac gcgcggcgtc acgcccggcg tgagatccgc      1080
     ctgaactgcc ggacgtcgtc cgacggcgcc gtcctcgagg tcgccgacga cgggccgggg      1140
     atcgctgtgc cggatcggca gcggatattc gaacggttcg tccgcctcga tacgccccgt      1200
     acccgcgact cgggcggtgc gggactgggc ctggcaatcg tcgccgagat cgtcgcgaca      1260
     cacggtggca cgatcgacgt caccgacagc ggcacgggcg gagcgcgatt cgtgatcacc      1320
     ctccccgcgg acggtacccg tcagtcgtct ccggacttca gccggtaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page