(data stored in ACNUC7421 zone)

EMBL: CP000431.PE76

CP000431.PE76        Location/Qualifiers
FT   CDS_pept        84185..84610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91912"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM4"
FT                   /protein_id="ABG91912.1"
FT                   /translation="MRLTTLGDLPARIATGGFILHSGIQKWSADEQTAQGIHGMAAGAF
FT                   PFLNAIPPERFIKLLSVAEIGTGAALLTPFVPSAVAGAALTGFSGGLVAMYARTPALRN
FT                   PGSIWPNENGIAVAKDVWMLGIGLGFVLDGLSRSRCR"
     atgcgactga ccacactcgg cgaccttccc gcgcgcatcg cgaccggggg tttcatcctc        60
     cattcgggga tacagaaatg gtcggcggac gagcagaccg cccagggcat tcatggtatg       120
     gcggcggggg cgttcccgtt cttgaacgcg attccgccgg aacggttcat caagttgctg       180
     tcggtcgccg agatcggcac gggcgcagcg ctgctcacac cgttcgtacc ctccgccgtg       240
     gccggggcgg cgctcaccgg gttctccggc ggcctcgtgg ccatgtacgc gaggacgcct       300
     gcactgcgta accccggcag catctggccg aacgagaacg gcatcgccgt cgccaaggac       360
     gtgtggatgc tcggcatcgg gctgggtttc gtgctcgacg ggttgtcgcg ttcccgctgc       420
     cgctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page