(data stored in ACNUC7421 zone)

EMBL: CP000431.PE77

CP000431.PE77        Location/Qualifiers
FT   CDS_pept        complement(84652..85188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00077"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition; GO_process: GO:0006725 - aromatic
FT                   compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91913"
FT                   /db_xref="GOA:Q0SKM3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM3"
FT                   /protein_id="ABG91913.1"
FT                   /translation="MSVLGQMDSFRRVFPTARRNRADLLRWLRRRPQLLAAVGFHEFAL
FT                   ATSARVDPRLKALGEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPKFRESSEFDD
FT                   TEKLVLEFAEAITRTPAHIGEGLRRSLLAEFSEAQLTELAAAIAWENHRGRLNQALGVR
FT                   PSGFSDSDFCVVPEQ"
     atgagcgtcc tcggtcagat ggactcgttt cgccgtgtct ttcccaccgc ccgccgcaac        60
     cgggcagacc tgttgcgctg gttgcggcgc cgaccgcagc tactcgccgc cgtcgggttc       120
     cacgagttcg cgctcgcgac cagcgccagg gtcgaccccc gcctcaaggc gctcggcgag       180
     atcaaggcgg ccgcgctgac caactgcgag tactgcctcg acatcggatc ggcgttcagc       240
     cgcgcgctcg gagtgagcga cgcgcagttg cgcgccctcc cgaagtttcg ggagagcagc       300
     gaattcgacg acaccgagaa gctggtgctg gaattcgccg aagccatcac ccgcacgccc       360
     gcccacatcg gcgagggcct gcggcgctca ttgctcgccg agttctccga ggcgcagctg       420
     accgaactcg ccgcggccat cgcctgggag aaccaccggg gacgtctcaa tcaggcgctc       480
     ggtgtgcgtc cctcgggttt ctccgacagc gacttctgcg tcgtgcccga gcagtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page