(data stored in ACNUC7421 zone)

EMBL: CP000431.PE8

CP000431.PE8         Location/Qualifiers
FT   CDS_pept        15092..15310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00008"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_function: GO:0004222 - metalloendopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU2"
FT                   /protein_id="ABG91844.1"
FT                   /translation="MQIDSIRIMRTIAAAFPEITTLGGWRPTGDVTPDHPDGRAVDIMI
FT                   PDSASAPGKALGDTIARAAEGDCRDNG"
     atgcagatcg actcgatccg catcatgcgc acaatcgcgg cggccttccc cgagatcacc        60
     accctcggcg gatggcgccc caccggcgac gtcaccccgg atcaccccga cgggcgcgcg       120
     gtcgacatca tgattcccga ctccgcgagc gccccaggga aggcactcgg cgacacgatc       180
     gcccgggctg cggaggggga ctgtcgggat aacggttga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page