(data stored in ACNUC7421 zone)

EMBL: CP000431.PE80

CP000431.PE80        Location/Qualifiers
FT   CDS_pept        complement(86531..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00080"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91916"
FT                   /db_xref="GOA:Q0RVL2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL2"
FT                   /protein_id="ABG91916.1"
FT                   /translation="MAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGVSRETLRNWVR
FT                   AERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLETEREILRKAA
FT                   KYFAGETNW"
     atggcgatga aggcgtactc ggcggagttc aaggccgatg ccgtcgcgct gtacctgtcc        60
     gacccgagcc acacctttga gggcatcggc aacgacctgg gagtcagccg cgagaccctg       120
     cgcaactggg tgcgggccga acgcaaacgc accggtacct ccacggccga gctccgggcc       180
     gacggggctg cgcggccggc atcccgggcc ggcgaggtat cgtccgagtc cgtgttggag       240
     gaagaaaaca agcagctcaa ggcccaaatc cggaagctcg aaaccgagcg ggagatcctg       300
     cgcaaggccg cgaagtattt cgcgggcgag acgaattggt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page