(data stored in ACNUC7421 zone)

EMBL: CP000431.PE82

CP000431.PE82        Location/Qualifiers
FT   CDS_pept        87818..88729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91918"
FT                   /db_xref="GOA:Q0SKL8"
FT                   /db_xref="InterPro:IPR027948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL8"
FT                   /protein_id="ABG91918.1"
FT                   /translation="MPMTSHHPRLQWAVPALLLTLIYAASLTVYGLSSRTGDDDGPFEI
FT                   GSDEVVVLVTAKSLQPTTDRVQAEVTIAVGEDFLHANGDTLNRDITLLLVPSTSHEEIV
FT                   FRAGASATTFDTEFIATGNAAYWPFDRFEVNPMVVEAYQGLGADRELVPTALLLEGRVD
FT                   GWKARAEEVAVDTDLSRNGTGAALMFARTGGNLIYAGILLLMMTILAGLAAFVALQTFR
FT                   RKRAVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFVFC
FT                   WWRDSEAPAQHEVVATRAPGSE"
     atgcccatga catcccacca cccccggctc cagtgggccg tcccggcgct tctcctcacg        60
     ctgatctacg ccgcgtcgct caccgtgtac gggctgagca gccgcaccgg cgacgacgac       120
     ggaccgttcg agatcggtag cgacgaggtc gtggtcctcg tgacggcgaa gtcgctgcag       180
     ccgacgaccg accgggtgca ggccgaggtg acaatcgccg tcggtgagga tttcctccac       240
     gccaacggcg acacactgaa ccgggacatc acgctgctgc tcgtcccgag caccagccac       300
     gaggagatcg tcttccgggc gggcgcctcg gccacgacct tcgacaccga gttcatcgcc       360
     accggcaacg cggcctattg gccgttcgac cggttcgagg tgaatccaat ggtggtggag       420
     gcgtatcagg ggctcggcgc cgaccgtgaa ctggtgccca cggccctcct gctggagggc       480
     cgtgtcgacg ggtggaaggc acgcgccgag gaggttgcgg tcgatacgga cctgtcccgg       540
     aacggtaccg gcgccgcgct gatgttcgcg cgcacgggcg ggaacctgat ctacgccgga       600
     atcctgttgc tgatgatgac gatcctcgcg ggcctcgccg cattcgtcgc gttgcagacg       660
     ttccgccgta agcgcgccgt caacacggac atgctgggct ggatggccgc gatgctgttc       720
     gccgtcgtgc cgttgcgtgg aatcctgccg ggaagcccgc cgatcgggtc gtgggtcgac       780
     atcgccctca cggtgtgggt ggtctctaca ctcgtcgcgt cgctggccct gttcgtgttc       840
     tgctggtggc gggacagcga agcgcccgca cagcacgagg tggttgccac gagagcgccg       900
     ggttcggaat ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page