(data stored in ACNUC7421 zone)

EMBL: CP000431.PE83

CP000431.PE83        Location/Qualifiers
FT   CDS_pept        88738..89190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00083"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91919"
FT                   /db_xref="GOA:Q0SKL7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91919.1"
FT                   /translation="MVRRTGTVRPPWYLAHVNKVIVGLHRLGVPMPMPALTVPGRKTGV
FT                   LRSTPVSPYEVDGRRYVVAGYAESDWAKNVLAAGRGELTRGRRRERVRLVALPMSERGR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRIEPLD"
     atggtgcgcc ggaccggaac agtgcggccg ccctggtatc tcgcccacgt gaacaaggtg        60
     atcgtgggcc tgcaccgctt gggcgttccg atgccgatgc cggcgctcac cgtccccggc       120
     cggaagacgg gggtgctccg gtcgaccccc gtgtcaccgt acgaggtgga tggccggcgc       180
     tacgtcgtcg cgggatacgc cgaatcggac tgggcgaaga atgtcctggc cgccgggcgc       240
     ggtgagctga cgcgggggcg tcgccgcgaa cgcgtccggc tggtcgccct gcccatgtcg       300
     gagcggggcc ggatcctccg cgagttcccg atccgggtgc cgcacggagt caccatgttc       360
     ctcaaggccg ggacggtcgc gaattcctcg ccggaggcgt tcgcggccgc cgcggaccgg       420
     tgcgaggtgt tccgcatcga gccgctcgac tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page