(data stored in ACNUC7421 zone)

EMBL: CP000431.PE84

CP000431.PE84        Location/Qualifiers
FT   CDS_pept        complement(89196..89708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00084"
FT                   /product="possible secreted copper binding protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005507 - copper ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91920"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91920.1"
FT                   /translation="MKTGTTPARSGASGIRSHRHPEATTMKRVLTLVLPILLAVFALAA
FT                   CGSDGDDSSGSAESAHGGDHPMSGMPSMSMSMPMSMPAGAGQAGGHEILISDFKYTLPG
FT                   TFAPGEEVTVRNNDTAEHTVTADTGDLFDVEVEPGATATFTVPGQPGTFAFHCAYHPNM
FT                   VGTLEVR"
     gtgaaaacgg gtactactcc cgcgaggagc ggggcgtcgg gcatccgttc tcatcgtcat        60
     ccggaggcga ccaccatgaa acgcgttctg acacttgtcc tgccgatcct gctggccgtc       120
     ttcgcgctgg ccgcgtgcgg aagtgacggt gacgactcgt ccggttcggc ggaatcggcg       180
     cacggcggcg accatcccat gtccggcatg ccgtcgatgt ccatgtcgat gccgatgtcc       240
     atgcctgcgg gggcgggtca agcgggcggg catgagatcc tgatctccga tttcaaatac       300
     accctgcccg gcacgttcgc gccgggagaa gaggtcaccg tccgcaacaa cgacaccgcc       360
     gaacacaccg tgacggcaga caccggcgac ctgttcgacg tggaggtcga accgggtgcg       420
     accgcgacgt tcaccgttcc cggtcagccg ggcaccttcg cgttccactg cgcgtatcac       480
     ccgaacatgg tgggcacact cgaggttcgg tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page