(data stored in ACNUC7421 zone)

EMBL: CP000431.PE86

CP000431.PE86        Location/Qualifiers
FT   CDS_pept        90746..92182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91922"
FT                   /db_xref="GOA:Q0SKL4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91922.1"
FT                   /translation="MEPHVRLVTRRRRTGPPQCHRDRRPRHRADAVAHRLRGTCSGVDR
FT                   RLLPLDTRIAGSAEHRTRHDRRGPVSPHRPGHRRQRTAGQSRQTTVTTGAGGHDDSVAQ
FT                   PHSPEQEQPIVAAEEGAARISTAAHPLGKPGPRFDRRSPFFIGMAGAAGVAVTYALIEV
FT                   VLAARGVLVLIAVAAFLAIGLEPAVSWLVRHGFPRWAAVATVFVLAFAVLAGFLAAAIP
FT                   PMVTQGGALVHNAPDYLGHLEQRYPVLEELSTRFHLQDELRRALDASNAPMVVGGLVGA
FT                   GKFVFSAISGTVIVVVLTAYFLADFAHIRSSIYRLAPNSRRPRTILIGDEIFAKVGGYV
FT                   LGNLLISLITAVLTFVWLVAFDVPYPLLLAVLVAVLDLIPVVGSTLAGVVVALVALTVS
FT                   LLVSLATIVFFIALRLFEDYLLVPRIIGRTVKVPPMVTVVAVLIGGALLGIVGALLAIP
FT                   VAAAVLLLARETVFPQLDRG"
     gtggaaccgc acgttcggct ggtcactcgg cgtcgaagga ctgggccgcc gcagtgtcat        60
     cgtgatcgac ggcctcggca tcgggcggat gccgtcgccc accgtctgcg cggaacgtgc       120
     agtggagttg atcgacgact actgccgctc gacacccgta tcgccgggag tgccgagcac       180
     cggacccggc acgaccgccg cggaccggtg tccccgcatc ggccgggaca ccgccggcag       240
     cggacggcgg gacagagtcg tcagacgacc gtgaccacgg gcgccggggg ccacgacgac       300
     agcgtggccc aaccgcattc ccccgagcag gagcagccga tcgtcgccgc ggaggagggc       360
     gcggcgcgca tcagcacggc ggcgcatccg ctcgggaagc ccggaccgcg cttcgatcgc       420
     cggtcaccgt tcttcatcgg gatggcgggg gccgccggtg tcgccgtcac gtacgccctg       480
     atcgaggtcg ttctcgcggc ccgcggggtg ctggtcctca tcgccgtcgc cgcattcctc       540
     gcgatcggcc tcgaacctgc ggtgtcctgg ctggtgcggc acggttttcc ccgatgggcc       600
     gcggtcgcaa cggttttcgt cctcgccttc gccgtgctgg ccgggttcct ggccgccgcg       660
     atcccgccca tggtgacgca gggcggcgca ctcgtgcaca acgccccgga ctacctggga       720
     cacctcgagc agcgctaccc ggtattggag gagctcagca cccgcttcca cctgcaggac       780
     gaactgcggc gggcactcga cgcgagcaac gcgccgatgg tggtcggcgg gctcgtgggt       840
     gcgggcaagt tcgtgttcag cgccatcagc ggcaccgtga tcgtggtcgt gctcaccgcc       900
     tatttcctgg ccgacttcgc acacatccgg tcgtcgatct accgcctggc cccgaactca       960
     cggcgacccc gcacgatcct gatcggtgac gaaatcttcg cgaaggtcgg cggatacgtg      1020
     ctcgggaatc tcttgatctc gttgatcacc gccgtcctca cgttcgtgtg gctggtcgcc      1080
     ttcgacgtcc cctacccgtt gctgctggcc gtcctggtcg ccgtgctgga tctgattccg      1140
     gtggtcggct ccaccctcgc cggcgtggtg gtggcgctgg tcgccctcac cgtctccctg      1200
     ctggtgtcac tggccaccat cgtcttcttc atcgccctcc gcctgttcga ggactatctt      1260
     ctcgttcccc gcatcatcgg ccgcaccgtc aaggtgcccc cgatggtcac cgtcgtcgcc      1320
     gtcctcatcg gtggcgcgct gctggggatc gtgggggcgc tgctcgcgat ccccgtcgcc      1380
     gccgccgttc tgctcctcgc ccgtgagacg gtgtttccgc agctcgaccg cggctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page