(data stored in ACNUC7421 zone)

EMBL: CP000431.PE87

CP000431.PE87        Location/Qualifiers
FT   CDS_pept        92302..93687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00087"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004144 - diacylglycerol
FT                   O-acyltransferase activity; GO_function: GO:0005554 -
FT                   molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91923"
FT                   /db_xref="GOA:Q0SKL3"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL3"
FT                   /protein_id="ABG91923.1"
FT                   /translation="MSVMSPTEAMFVLFETPSHPMHVGALELFEPPRESGPDHARAMFE
FT                   ALISHEGASDTFRRRAVRPLRGASYPWWSFDDRIDLGYHVRHTAVPGRGRMEDLLSLVS
FT                   QMHGMPLDPQHPMWEMHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPDARD
FT                   CPAPWTPGVAGVPRRESVLPVAVVRAGVRAATSIVGVLPALAKVAYDGVREQHLTLPLQ
FT                   SPPTMLNVPVGRARKLAARSWPIRRLVSVATAAHTTINAVVLAMCSGALRRYLLEQYAL
FT                   PDAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISESVEHTNR
FT                   VFGALSHTQFQLMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRYWNGARLD
FT                   AVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRHAVPHLQRIITHLETSLSDLEHAVAA
FT                   SGT"
     atgtcggtga tgagtcccac cgaggcgatg ttcgtgctgt tcgagacgcc gtcgcatccc        60
     atgcacgtgg gtgcgctcga actgttcgaa ccgccgcgcg agtcggggcc cgatcatgcc       120
     cgggccatgt tcgaggcgct gatctcgcac gagggcgcgt cggacacgtt ccgccggcgc       180
     gccgtacgcc cgctccgcgg ggccagttac ccctggtggt cgttcgacga ccgcatcgat       240
     ctcggctacc acgtgcggca caccgcggtc ccgggccggg gccggatgga ggacctgctg       300
     tcgctggtgt cccagatgca cggcatgccg ctcgatccgc agcacccgat gtgggagatg       360
     cacgtcatcg aggggctcgc cgacggacgg acggccgtgt tctcgaagat tcacctgtcg       420
     ttgatggacg gaccggcggg gctgcgactt ctccaccacg cgctgtcgac cgaccccgac       480
     gcccgcgact gccccgcacc gtggactccc ggggtcgccg gtgtgccacg gcgcgaatcc       540
     gtgttgccgg tggccgtggt ccgggccggg gtgcgggccg ccaccagcat cgtcggggta       600
     ctgcccgcgc tcgcgaaagt cgcctacgac ggcgtccgcg agcagcatct gacccttccc       660
     ctgcagtcgc cgcccacgat gctcaacgtt ccggtcggcc gggcccggaa actggcggca       720
     cgatcgtggc cgatccggcg cctggtgtcg gtggccaccg ccgcccacac cacgatcaac       780
     gcggtggtgc tcgcgatgtg ttcgggggct ttgcgccggt atctcctcga gcagtacgcg       840
     ctgccggacg cgccgttgac ggcgatgctg cccgtgcccc tcgacctcgg cggcacgatg       900
     atcggaccgc gcggccgcga tcacggcgtc ggcgccatgg tcgtcggcct ggccaccgac       960
     gaagctgatc cggcggcacg cctcgcccgc atcagcgagt cggtcgagca caccaaccgg      1020
     gtgttcggcg cgctgagcca cacccagttc caactgatga gcgcgctggc gatcagcccg      1080
     atcctgctcg agccggtccg acggttcgtc gacgacactc ccccgccgtt caacgtgatg      1140
     atctcgtaca tgccgggccc gtcgaggccg cgatactgga atggggcccg cctcgacgcc      1200
     gtgtatccgg cgccgacggt cctcgggggt caagcactca gcatcaccct caccagccgg      1260
     tccggtcagc tcgacgtcgg cgtggtgggc gatcggcacg ccgtcccgca tctacagcgg      1320
     atcatcacgc acctggagac gtcgctcagc gatctcgagc acgcggtcgc cgcatccggc      1380
     acctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page