(data stored in ACNUC7421 zone)

EMBL: CP000431.PE88

CP000431.PE88        Location/Qualifiers
FT   CDS_pept        complement(93691..94737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91924"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL2"
FT                   /protein_id="ABG91924.1"
FT                   /translation="MSDTVAQSGTSMPFPKPRGPVSDLLFSILRADVADAEPFVAAARS
FT                   LASSARDSPRAFLFDEDAQICLTALYELHLQGITGVGDEWEWNSDLIAARSALEVPFDA
FT                   AIRDVADAPTGADDVVAALWAMTAPSTAPGLSGHMAHEADLTQFRELLIHRSLNQLREA
FT                   DVHTFGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDDYAHYIDAV
FT                   PAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGFGKAATLFF
FT                   DEHVEADSVHEQIVCRDLAGGLVAARPDVAGDILLGAAACLAFDDLVGDHVARCWEENR
FT                   TSLRQPPG"
     atgtcggaca cggtcgcgca atcgggaacg tccatgccct ttccgaagcc gcgtgggcct        60
     gtcagcgacc tcctgttctc cattctgcgc gcagacgtcg ccgatgccga accgttcgtg       120
     gcggcggcac gctccctcgc ctcgtcggcg cgcgacagtc cgcgggcgtt cctcttcgac       180
     gaggacgcgc agatctgcct gaccgcgctc tacgaactgc acctgcaggg gatcaccggt       240
     gtcggcgacg aatgggagtg gaacagcgac ctgatcgccg cccggtcggc gctcgaggtt       300
     ccgttcgacg ccgcgatccg tgacgtcgcc gacgcgccga ccggcgccga cgacgtggtg       360
     gcggcactgt gggcgatgac cgcccccagc acggcgccgg ggctgtccgg tcacatggcc       420
     cacgaggcgg atctcaccca gttccgggaa ctgctgatcc accgttccct gaaccagttg       480
     cgtgaggccg acgtgcacac gttcggcatt ccgcggctcg cgggcgcgcc gaaggcggcg       540
     ctggtggagg tgcagtccga cgagtacggc ggcggcagac ccgagcggat gcactcggcg       600
     ctgttcgcca ccaccatgcg tgaactcggg ttgtccgacg actacgcgca ctacatcgac       660
     gcggtccccg ccgtgacgct ggcgtccctc aatgcgctgt ccctgttcgg cctgcaccgc       720
     agccggctcg gggccctggt gggacacctg tgcgcggtgg agaccacgtc cgcgttgccg       780
     agcaagaaat acgccgccgg actgcgccgc ctcggattcg ggaaggcggc caccctgttc       840
     ttcgacgagc acgtggaggc cgactccgtg cacgaacaga tcgtctgccg cgacctcgcc       900
     ggcggactgg tcgcggcccg gcccgacgtg gccggcgaca tcctgctggg ggctgcggcc       960
     tgcctcgcct tcgacgacct cgtcggcgat cacgtcgcac gatgctggga ggagaaccgc      1020
     acgtcgctgc ggcagccgcc cggttag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page