(data stored in ACNUC7421 zone)

EMBL: CP000431.PE89

CP000431.PE89        Location/Qualifiers
FT   CDS_pept        95348..95803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91925"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91925.1"
FT                   /translation="MKSVLSALPTRYGPPDSSTLFSWAVEPEHGRLSVVSAPGAGGILV
FT                   VRISGDIDVTTLHTFGNHLDEAINERLPFVLDLTDVQFFCASALPVLGTMAARARRLTV
FT                   PWAVTGNNALRRPLTAMKMAAQIPFCADLEDAFLLVAQGVHQGGRSA"
     atgaaatctg ttctcagtgc gctgccgaca cgctacggcc cacccgacag ttcgacgctg        60
     ttcagttggg ccgtcgagcc cgagcacggg cggctctccg tcgtcagtgc gcccggtgcc       120
     ggcgggatcc tcgtggtccg gatatccggt gacatcgacg tcaccaccct gcacaccttc       180
     gggaatcatc tcgacgaggc gatcaacgaa cgacttccgt tcgtgctcga cctgacggac       240
     gtgcaattct tctgcgcgtc tgccctgccg gtactcggca ccatggccgc ccgcgcccgc       300
     cggctcaccg tgccgtgggc ggtgaccggc aacaacgcac tccgcaggcc gttgacggca       360
     atgaagatgg ctgcacagat cccgttctgc gccgacctgg aggacgcctt cctgctggtc       420
     gcccagggag ttcaccaggg tgggcgctcg gcgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page