(data stored in ACNUC7421 zone)

EMBL: CP000431.PE91

CP000431.PE91        Location/Qualifiers
FT   CDS_pept        97292..98362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91927"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK9"
FT                   /protein_id="ABG91927.1"
FT                   /translation="MIRVASVPESHVYVRHLGEPDGGGGDVVRLADPVPADGRKVPGGW
FT                   WPPLMLDPGWISRHHREFDVFHIHFGFDAIEPADMKDIVHELSARGKPLVYTVHDLRNP
FT                   HHPDAGPHLEVLDVLVPAATELATLTEGAAAVIDANWARTATVLAHPHVVERPLVERPR
FT                   PDSDDFVVGVHVKSLRANMDPFPVLDALTRTVAALRGARLQIDIHDEIFRPDSYWYAPN
FT                   AAARLLRYRDADRVDVRVHPYFTDAQLWKYLSSLSVSVLPYRFGTHSGWLEACYDLGTA
FT                   VVAPTCGFYAQQQDCATFGFDEDSFDAASLDRAVRTLHRSATARATWHERATQRRLLAQ
FT                   AHHNLYERALSWRALP"
     atgattcgcg ttgcctccgt cccggagtcc catgtctacg ttcgtcatct gggcgagccg        60
     gacggaggcg gcggcgacgt cgtccgtctc gccgatcccg tcccggcaga cggtcgcaag       120
     gtccccgggg gatggtggcc accgctcatg ctcgatccgg gctggatcag ccgccaccat       180
     cgcgaattcg acgtgttcca cattcatttc ggattcgacg ccatcgaacc ggcggacatg       240
     aaggacatcg tccacgagtt gtccgcccgc gggaagccct tggtctacac ggtgcacgac       300
     ctccgcaacc cacaccaccc cgacgccggg ccgcacctgg aggttctcga cgtgctggtg       360
     cccgccgcta ccgagttggc cacactcacc gagggcgccg cagccgtcat cgacgcgaac       420
     tgggcccgca ccgcgacggt cctcgctcac ccgcacgtcg tggagcgccc tctggtcgag       480
     cgtccccgcc cggactcgga cgacttcgtg gtcggggtgc acgtcaagag tctgcgcgcc       540
     aacatggatc cgttcccggt cctggacgcg ctgacccgca cggtcgccgc tctccgcgga       600
     gcgcgtctgc agatcgatat ccacgacgag atcttccgac cggacagtta ttggtacgcg       660
     ccgaacgcgg cggcgcgact cctgcgctac cgcgacgccg atcgggtcga cgtgcgcgtc       720
     cacccgtact tcaccgacgc ccagttgtgg aagtacctgt cgtcgctgtc ggtctcagtg       780
     ctgccctacc gcttcggcac ccactccggg tggctcgagg cgtgctacga cctgggtacc       840
     gcggtggtcg ccccgacatg cggcttctat gcgcagcaac aggactgtgc cactttcgga       900
     ttcgacgagg actccttcga cgccgcctcg ctcgaccggg ccgtccgcac cctgcaccga       960
     tccgcgacgg cccgggcgac gtggcacgag cgcgcaaccc agcggcgcct gctcgcgcag      1020
     gcgcatcaca acctgtacga aagagcactg tcgtggcgtg cgctgccgtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page