(data stored in ACNUC7421 zone)

EMBL: CP000431.PE93

CP000431.PE93        Location/Qualifiers
FT   CDS_pept        99468..100463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91929"
FT                   /db_xref="GOA:Q0SKK7"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK7"
FT                   /protein_id="ABG91929.1"
FT                   /translation="MIGYYIHHHGTGHRVRASSICAALEAPVTALSSAPVDPGGPFVDR
FT                   VRLARDDRGSSPENPTADGALHWVPAHDVGLRTRMSRIASWVDATRPSLMVVDVSVEVA
FT                   AFVRLLGVPVVMIAMPGERTDPAHRLGYRLADHIVAAWPQAMYDPEWLREFAHKTTFVG
FT                   GISRFDGRASAAGPASSRPRILVLSGTAVTVGDVRRCAHVHRDYRWQALGVPGAPWIED
FT                   PWPELCGADVVVSDAGQNSVAEIAAARRPAIVIAQPRPFGEQSATAHSLASGGLAVSIP
FT                   QWPEVTRWPALLDRALALGGDSWVRWQTAGAATRAAAVIDSLAKRAESAP"
     gtgatcggct actacatcca ccaccacggg acgggccacc gggtgcgcgc ctcgagcatc        60
     tgcgcggccc tggaggcacc ggtcaccgct ctctcctcgg cgccggtcga ccccggcggt       120
     ccattcgtgg accgtgtccg gctggcgcgc gacgaccggg gctcctcccc cgagaacccc       180
     accgccgacg gcgcactgca ctgggttccc gcccacgacg tcgggctgcg gacccgcatg       240
     tcccggatag cgtcgtgggt cgacgcgacc cgacccagcc tgatggtcgt cgacgtctcg       300
     gtggaggtgg ctgcattcgt tcgactgctg ggcgtgcccg tggtgatgat cgcgatgccg       360
     ggagagcgca cagatccagc ccatcgtctc ggctaccggc tcgccgacca catcgtggcc       420
     gcatggccgc aggcgatgta cgacccggaa tggttacggg aattcgcgca caagaccaca       480
     ttcgtcggcg ggatcagtcg gttcgacggc cgcgcatccg ccgccggtcc cgcctcctcc       540
     cgaccccgga tcctggtgct cagcggcacc gcggtgacgg tcggggacgt ccgtcggtgc       600
     gcccacgtgc atcgcgacta tcgatggcag gcactcgggg ttccgggcgc accgtggatc       660
     gaggacccct ggccggaact gtgcggcgcc gacgtcgtcg tgtccgacgc cgggcagaac       720
     tcggtcgccg agatcgccgc cgcccgccgt ccggccatcg tcatcgcgca gccgcgtccg       780
     ttcggtgaac aatcggccac ggcgcactcg ctcgcgagcg gtggactcgc cgtgtcgata       840
     ccgcagtggc cggaggtgac cagatggccg gcgctgctcg accgggcact cgccctcggc       900
     ggcgacagct gggtgcgttg gcagaccgcg ggcgccgcca cccgcgcagc ggcagtcatc       960
     gacagcctgg cgaaacgggc ggaatcggcg ccgtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page