(data stored in ACNUC7421 zone)

EMBL: CP000431.PE95

CP000431.PE95        Location/Qualifiers
FT   CDS_pept        complement(101287..102057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0007582 - physiological process"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91931"
FT                   /db_xref="GOA:Q0SKK5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK5"
FT                   /protein_id="ABG91931.1"
FT                   /translation="MAETVGERPESMSPKLDNATIAAQLGSLATALDEFNRNSGSQVEM
FT                   SLLLQRVCDQVVDAIADADMAGISLLRDGRVVTVAYTDEAVREIDIPNFQALDGDYFGV
FT                   AGTRKVVKARLGEAAARWPSVADNLDQAGMRSFLSAPLAVDEALAGTLNIYGQGDHGFS
FT                   ELDAVVLLVYTTAIEGLLRSARSVELARNEVSGLTKAMKSRAVIEQAKGIVMALRGVPA
FT                   DQAFEILVAQSQQEHVKLAEVARRIVESVTTNPE"
     atggccgaga ctgtgggtga gcgccccgag tcgatgtccc ccaagctcga caacgcgacg        60
     atcgccgccc aattgggctc cttggcaacc gcgttggacg agttcaatcg caattctggc       120
     tcgcaggtgg agatgagcct gctgcttcag cgggtctgcg accaggtggt ggacgcgatc       180
     gccgacgccg acatggccgg gatttcgctg ctgcgcgacg gacgggtggt gaccgtcgcg       240
     tacacggacg aggcggtccg tgagatcgac attccgaact ttcaggccct cgacggcgac       300
     tacttcggtg tcgccggaac gcggaaggtc gtcaaggccc ggctcgggga ggccgcggcc       360
     cggtggccgt cggtcgcgga caatctcgac caggccggca tgcgcagctt cctatccgcg       420
     ccgctcgccg tcgacgaggc cctcgccggc acactcaaca tctacgggca gggggatcac       480
     gggttcagcg aactcgacgc cgtggtgctg ctcgtctaca cgacggcgat cgagggtttg       540
     ctgaggagcg cccgcagcgt ggagttggcc aggaacgagg tttcgggtct cacgaaggcc       600
     atgaagtccc gtgcggtcat cgagcaggcc aagggaatcg tgatggcgct gcggggcgtg       660
     cccgcggacc aggcgttcga gatcctcgtc gcgcagtcgc agcaggagca cgtcaagttg       720
     gccgaggtgg cgcgccgcat cgtcgagtcg gtgacgacga atcccgagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page