(data stored in ACNUC7421 zone)

EMBL: CP000431.PE96

CP000431.PE96        Location/Qualifiers
FT   CDS_pept        complement(102144..103286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91932"
FT                   /db_xref="GOA:Q0SKK4"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK4"
FT                   /protein_id="ABG91932.1"
FT                   /translation="MHVTTLRRLRSWAGDGQRNTVVVQSAKAATAAVLAWILAERLLGL
FT                   PQPFLAPYAAVFMIEVTVSRSLRVAGEQLAAVSLGVLLAAAVGMLLDSVTVGVGVAVLT
FT                   GLLLGRWHRFGSSGVWVAVTALLMVTYGDSDQPAILGDRILAIALGAGTGVAVNALLLP
FT                   PLYLRRSERAVTGLGSTATSLLCDVARELREPGTGGQPDRWAERAAHVRVQLDDALDAV
FT                   AWTDESARANMRRAAGPAAAGRKWKPAVVALSEGWPQCTEIVRATSLALAPQPPFGPLD
FT                   PEIRESAAAFVDALADVIRAEFAFADSRDAPVAACRTAEERLRNFEDAVSSHSGLTRGS
FT                   SMSAGSILRPSAAALSLLTGESPASPSGTGSVDGGGPGVE"
     ttgcacgtca ccacactccg acgtctgcgc tcgtgggcgg gggacggtca gcgaaacacc        60
     gtggtggtgc agtcggcgaa ggccgcgacc gctgcggtgc tcgcatggat tctggccgag       120
     cgccttctcg ggctgccgca gccgttcctc gcgccctacg cagcggtgtt catgatcgag       180
     gtcaccgtgt cgcgatcact gcgggtggcc ggcgagcaac tcgcggcggt ctcgctcggg       240
     gtgttgctgg ccgcggcggt cggaatgctg ctcgattcgg tcaccgtcgg tgtcggtgtg       300
     gcggtgctga cgggtctcct gctcggccgg tggcaccgat tcggttcgag cggggtgtgg       360
     gtggcggtca ccgcgctgct gatggtgacg tacggcgatt ccgatcaacc ggcgatactc       420
     ggcgaccgca tcctggcgat cgcgctcggc gccggcaccg gggtggccgt gaacgcgctg       480
     ctcctgcctc cgctgtacct gaggcggtcc gaacgcgcag tgacggggct gggttcgacg       540
     gccacgtcgc tgttgtgcga cgtggcccgg gagttgcggg aaccgggaac cggtggacag       600
     cccgatcgtt gggctgaacg ggcggcgcac gtgcgggtgc aactggacga cgccctggac       660
     gccgtggcct ggacggatga gagcgcgcgc gccaatatgc gacgcgccgc cggtccggcc       720
     gccgccggaa ggaaatggaa accggcggtc gtggcgctgt ccgagggctg gccccagtgc       780
     acggagatcg tccgcgccac ctcgctggcg ctggcgccgc aacccccgtt cggcccgctc       840
     gacccggaga tccgggagag tgcggccgcg ttcgtggacg cactggcaga cgtgatccga       900
     gccgaattcg ccttcgccga cagccgcgac gctccggtcg ccgcctgccg gacggcggag       960
     gagcggctcc gcaacttcga ggacgcggtg tcctcccaca gcggtctgac ccggggttcg      1020
     tcgatgagcg ccggaagcat cctccggccg tccgcggcgg cgctgagttt gctgaccggg      1080
     gaatctcccg cctcaccgtc cgggacggga tcggtggacg gaggcggtcc cggggtcgag      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page