(data stored in ACNUC7421 zone)

EMBL: CP000431.PHOU1

CP000431.PHOU1       Location/Qualifiers
FT   CDS_pept        130844..131491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU1"
FT                   /locus_tag="RHA1_ro00127"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91963"
FT                   /db_xref="GOA:Q0SKH3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH3"
FT                   /protein_id="ABG91963.1"
FT                   /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLQADLELAEHV
FT                   IDVSGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAKIA
FT                   RRRHPDHVVPDEVLGVFTEMGAVAVAQAKETEQVLQHRDPERARGLLTADEAMDDLHRS
FT                   LFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
     atgcgtactc gtttcgcgga gaatctcgac agcctgtccg gcgatctggc ctccatgtgc        60
     cggctgtccg ttaccgcgat gtcggaggcg agcgacgcac tgctgcaggc agacctcgag       120
     ctcgccgagc acgtcatcga tgtgagcggc gagctcgacg atgccgcggc gcactgggag       180
     aagcgtgcct tcgccctgct ggcgctgcag gcgccggtcg cgcacgacct ccggttcatg       240
     gtcggcggcc tccacatctc cgcggatctg caccgcatgg gcggtctcgc ggtgcacatc       300
     gcgaagatcg cgcgccgacg gcatcccgac cacgtcgttc ccgacgaagt cttgggcgtg       360
     ttcaccgaga tgggcgccgt cgccgtcgcg caggcgaagg aaaccgagca ggttctgcag       420
     caccgtgatc ccgagcgcgc acgcggtttg ctgacggcgg acgaggcgat ggacgatctc       480
     catcggagcc tgttcacgat cacccaggcc gaggactggc cgcacggtgt ccagtcggcc       540
     gtcgacatca ccctgctcgg ccgtttctac gagcggttct gcgaccacac ggtggagatc       600
     ggcaggcgcg tcatcttcct cgagacgggc agcctgcccg aacagtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page