(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHA

CP000431.XDHA        Location/Qualifiers
FT   CDS_pept        136845..138941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="RHA1_ro00135"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   domain"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91971"
FT                   /db_xref="GOA:Q0SKG5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91971.1"
FT                   /translation="MTLVDPKVIGTSAERLDAHDKVTGTALYAFEYPVDEPTYLHPILS
FT                   TIGRGRVTAMHTADAEALDGVLAVLTVFDAPRLADTSDGELAILQDAEVHFRGQFVGAV
FT                   VAESPEVARHGASLVRVDYDVESHDTDFRSGRGDLYTPEDVNAGFPTDTEDGDVDAALS
FT                   AAAVTVDQVYSTAMEHNNPMEPHAAIARWTPGGSGPVLTLHDSTQGVHSVRQTLAPLFG
FT                   LEVEQMRVIAPYVGGGFGSKGLPHAHDVLVVMAAQRVEGRPVKFALTRQQMFALSAYRT
FT                   PTVQHIRLGADADGRLTALSHEAVVQSAKIKEFAEQAAVPSRLMYSTPTRYTTHRLASL
FT                   DVPAPSWMRAPGETPGMFAAEVAMDELAEACGLDPIELRIRNEPEVDPSTGRPWSGRRL
FT                   TDCLREGARRFGWADRDATARARSDSQWQVGMGVASATYPANTSPGSVARIVYDSDGTY
FT                   TVQIGSVDIGTGAWTALTQIAADALGCPLDAIVLQIGDTNLPSATVAGGSTGTSSWGSA
FT                   IVAAARAFRDAHGTSPDPGAEARAGTPDNPDAEKFALHSFGAHFVEAHVHRDSCEIRVE
FT                   RMLGVFAIGRVINARTVRSQLLGGMTMGISMALHESSVNDPRFGHVVTQDLASYHVSTH
FT                   ADIRYLDAVCLDDVDEHANPMGSKGAGEIGIVGAAAAVANAVRHATGVRVRKAPIHLDD
FT                   LLPG"
     atgaccctcg tcgatccgaa ggtgatcgga acctccgccg aacggctgga cgcccacgac        60
     aaggtgaccg gcacggcgct gtacgcgttc gagtacccgg tggacgagcc gacctatctg       120
     cacccgatcc tgtcgacgat cggacgcggc cgggtcacgg cgatgcacac ggccgacgcg       180
     gaagccctgg acggggtgct cgcggtcctg acggtgttcg atgcgccccg cctcgcggac       240
     acctcggacg gtgaactcgc gatcctgcag gacgccgagg ttcatttccg cggccaattc       300
     gtgggtgcgg tggtggcgga gtcaccggaa gtcgcccgcc acggcgcgag cctcgtgcgc       360
     gtcgactacg acgtggaatc ccacgacacc gacttccgtt ccggtagggg cgatctgtac       420
     acccccgagg atgtcaacgc gggattcccg accgacaccg aggacggcga cgtcgacgcg       480
     gcactttccg ccgccgcggt cacggtcgat caggtgtact ccaccgcgat ggaacacaac       540
     aacccgatgg aaccgcacgc cgccatcgcc cggtggaccc caggcggcag cggaccggtt       600
     ctgacgctgc acgattcgac ccagggcgtc cactccgtgc ggcagacgct cgcaccgctg       660
     ttcggactcg aagtcgagca gatgcgggtg atcgccccgt acgtcggcgg cggcttcggc       720
     tccaaaggac tgccgcacgc gcacgacgtg ctcgtggtga tggcggcgca gcgggtggaa       780
     ggccggccgg tgaagttcgc gctcacccgg cagcagatgt tcgccctctc cgcgtatcgc       840
     acgccgacgg tgcagcacat ccggctcggg gcggacgccg acggacggct gaccgcgctc       900
     tcccacgagg cggtcgtgca gtccgcgaag atcaaggagt tcgccgaaca ggcggcggtc       960
     ccgtcgcggc tgatgtactc cacgcccacc cggtacacca cccaccgtct cgcgtccctc      1020
     gacgtgcccg ccccctcctg gatgcgtgcc cccggcgaga ccccgggcat gttcgcggcc      1080
     gaggtggcga tggacgaact ggccgaagct tgcgggctcg acccgatcga attgcggatc      1140
     cgcaacgaac ccgaggtcga cccgagtacc ggccgcccgt ggtcggggcg gcgcctcacc      1200
     gactgtctgc gggaaggcgc ccggcgtttc gggtgggcgg accgcgacgc gacggcgcgg      1260
     gcccggtcgg actcgcagtg gcaggtgggg atgggcgtcg cgtccgcgac gtatccagcc      1320
     aacacgtcac ccggatcggt tgcccggatc gtgtacgact ccgacggcac gtacaccgtg      1380
     cagatcgggt cggtcgacat cggtaccggc gcgtggaccg cgctcaccca gatcgccgcc      1440
     gacgcgctgg gctgcccgct ggacgcgatc gtcctgcaga tcggtgacac gaatcttccg      1500
     tcggcgaccg tcgcaggcgg ctccacggga accagttcct ggggcagtgc gatcgtcgcg      1560
     gcggcccgcg cgttccggga cgcgcacggc acgtcccccg acccgggggc ggaggcgcgt      1620
     gcggggacgc ccgacaaccc cgacgcggaa aagttcgcac tccattcgtt cggtgcccac      1680
     ttcgtggagg cgcacgtcca ccgcgattcc tgcgagatcc gtgtcgaacg catgctcggg      1740
     gtgttcgcga tcggccgggt gatcaacgcc cgcaccgttc gatcgcaact cctcggcggg      1800
     atgacgatgg ggatctcgat ggcgctgcac gagagcagcg tgaacgaccc ccggttcggt      1860
     cacgtcgtga cccaggacct tgcctcctat cacgtcagca cccacgccga catcaggtac      1920
     ctcgacgcgg tgtgcctcga cgacgtcgac gagcacgcca atccgatggg atcgaagggc      1980
     gccggtgaga tcggcatcgt cggggccgcg gccgcggtgg cgaacgctgt ccgtcacgcc      2040
     accggggtgc gggtccggaa ggcgccgatc cacctggacg acctactgcc cgggtga         2097
//

If you have problems or comments...

PBIL Back to PBIL home page