(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHB

CP000431.XDHB        Location/Qualifiers
FT   CDS_pept        135856..136848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="RHA1_ro00134"
FT                   /product="xanthine dehydrogenase FAD-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91970"
FT                   /db_xref="GOA:Q0SKG6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91970.1"
FT                   /translation="MIPFDYERATDVDSAVATVTGDPRASFLAGGTNLVDHMKLGVARP
FT                   HLLVDVSRLPLGDVVELPDGGLRIGAAVRNSDLAAHDVVRARYPMLSRALLSGASGQLR
FT                   NLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSAIGGYVRYHAILGASEHCVAVHPS
FT                   DMAVAMTALDGVVVVRGADGERRIPLSEFYRLPGDRPDRDTVLAHGDLVTAVELPPPPS
FT                   GNRSAYRKVRDRASFAFAVVSVAAELTIGDTSITSARVALGGVAHRPWRATLAEEVLVG
FT                   SPPTEATYTEAAAAELAAAQPLPGNEFKVALTRRVLASVLRSLAEEARR"
     gtgattccct tcgactacga gcgggccacc gacgtcgaca gtgccgtcgc cacggtcacg        60
     ggtgacccgc gggcgtcgtt cctcgccggc ggcaccaacc tcgtcgacca catgaagctc       120
     ggggtcgcgc gcccgcatct cctcgtcgat gtgagccggc ttcccctggg cgacgtcgtc       180
     gaactcccgg acggcgggct ccgaatcggg gcggccgtcc gcaacagcga cctcgccgct       240
     cacgacgtcg tccgcgcccg gtacccgatg ctgtcgcgcg ccctcctctc cggtgcgtcg       300
     ggccagctgc gcaacctcgc gaccacggcg ggaaatctgc ttcagcggac tcgctgcgtg       360
     tacttccagg acgtcacgac gccctgcaac aagcgggagc ccggcaccgg gtgttccgcg       420
     atcggcggtt acgtccgcta ccacgccatt ctcggtgcct cggagcactg cgtcgcggtg       480
     cacccgtccg acatggccgt cgcgatgacg gcgctcgacg gtgtcgtggt ggtgcgcggc       540
     gccgacggtg aacggcgaat cccgctgagc gagttctacc ggcttcccgg ggaccggccc       600
     gaccgcgaca ccgtcctcgc gcacggtgat ctcgtgacgg ccgtggagct gcccccgccg       660
     ccttccggga accggtccgc gtaccggaag gtgcgtgacc gtgcctcctt cgcgttcgca       720
     gtggtgtcgg tggccgccga gctgacgatc ggggatacgt cgatcacgtc ggcgcgggtc       780
     gcgctcggtg gggtcgcgca ccgaccctgg cgtgccacgc tcgccgagga ggtcctcgtc       840
     gggtcgccgc ccacggaggc cacgtacacc gaggccgctg cagcggaact cgctgcggca       900
     caaccgcttc ctggaaacga attcaaggtt gcactgaccc ggcgggtgct ggcgtcggta       960
     cttcgttccc tcgccgagga ggcgcgccga tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page