(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHC

CP000431.XDHC        Location/Qualifiers
FT   CDS_pept        135332..135859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="RHA1_ro00133"
FT                   /product="xanthine dehydrogenase Fe-S binding subunit"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91969"
FT                   /db_xref="GOA:Q0SKG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG7"
FT                   /protein_id="ABG91969.1"
FT                   /translation="MNVADSPRYRKITLTVDGEERNLEVDTRTTLLDALRDHLGVTAPK
FT                   KGCDHGQCGSCTVLLDGRRSTSCLTFAVAHHGERVVTAHGLADGEVLHAVQQAFVEQDG
FT                   LQCGYCTPGQICSVIGMLDEFLALHPSAVTENLTAPPELTDDEIRERMNGNLCRCGAYP
FT                   NILAAIRQAAEA"
     atgaatgtcg cggacagccc ccgctaccgg aagatcaccc tcaccgtgga cggtgaggaa        60
     cgaaacctcg aagtcgacac ccgcacgacg ctgctcgacg cgctccgcga ccacctcggg       120
     gtgaccgcgc cgaagaaggg ctgcgaccac ggccagtgcg gctcgtgcac cgtcctcctc       180
     gacggcagac gatccacgtc ctgcctcaca ttcgccgtcg ctcaccacgg ggaacgcgtc       240
     gtcaccgcac acggactggc cgacggcgag gtgctgcatg ccgttcagca ggcgttcgtc       300
     gagcaggacg gactgcagtg cggttactgc acgcccggtc agatctgttc ggtgatcggg       360
     atgctcgacg agttcctggc cctgcacccg agcgccgtca ccgagaacct gaccgctccg       420
     cccgaactca ccgacgacga gatacgcgag cggatgaacg gaaacctctg ccggtgcggc       480
     gcgtatccga acatcctcgc ggcgatcagg caggcggcgg aggcgtga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page