(data stored in SCRATCH3701 zone)

EMBL: CP000435.AROQ

CP000435.AROQ        Location/Qualifiers
FT   CDS_pept        554384..554857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="sync_0578"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by similarity to SP:P43877; match to
FT                   protein family HMM PF01220; match to protein family HMM
FT                   TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47268"
FT                   /db_xref="GOA:Q0ICM6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM6"
FT                   /protein_id="ABI47268.1"
FT                   /translation="MFKSRAMHLLLLNGPNLNLLGQREPGLYGRQTLDQIETALSERAS
FT                   ADGLTLECFQSNFEGALVERIHQAMGKVDGILINAGAYTHTSIAIRDALLGTAIPFVEL
FT                   HLSNTHAREPFRHRSFLADRAVGVICGFGPVSYDLALDGLVRYLRNSASGGVG"
     atgtttaaga gtcgggccat gcacctgttg ctgctcaacg gccccaacct caatctgctg        60
     ggccagagag aaccaggcct ttatggtcgc caaaccctgg atcagatcga gacggcactc       120
     agcgagcggg ccagcgctga tggcctaacg ctggagtgtt tccagagcaa ttttgaaggt       180
     gccttggtgg aaaggatcca tcaggcgatg gggaaggtgg atggcatcct catcaatgca       240
     ggggcttaca cccatacctc gattgcaatc cgtgatgccc tgttggggac agccatcccc       300
     ttcgtggagc tgcacttgag caacacccat gcccgtgaac catttcggca tcgttcattt       360
     ctcgccgacc gtgccgttgg cgtgatttgt ggttttggcc ccgttagtta cgacttggcc       420
     ttggatggtt tggtccgcta cctgcggaac tctgcgagcg gaggggtggg ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page