(data stored in SCRATCH3701 zone)

EMBL: CP000435.ASNB

CP000435.ASNB        Location/Qualifiers
FT   CDS_pept        complement(187219..189033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="sync_0178"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46358"
FT                   /db_xref="GOA:Q0IDQ7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ7"
FT                   /protein_id="ABI46358.1"
FT                   /translation="MCGIFGGFSFEASAFSGELPVMMAKSILHRGPDNTGYWSNEEALL
FT                   GNCRLSIIDLSKNGNQPFYSKNKDIVVVQNGEIYNYIELRDLLIGEGACFQSDSDTEVV
FT                   LHAYAIWGPDFVSRLNGMFSIAIYDSRVSTAVLRLYRDRLGVKPLYYCIDGGCLWFGSE
FT                   IKAILAAGVKANPNYNALRSYFALNYIPPPQTAFANIYHLQPGHSAAITKSGVKLNRYW
FT                   DCNDIGLNEDITTAEAKSGIITLLDDAVRIRLRSDAPFGAFLSGGLDSSSVVGLMSLYK
FT                   ESPTKTFSIGFEDARYDETSYAEMASKRFGTYHSTKIMSENALDIWSKFIWHCDQPHGD
FT                   ISFIPTYQVSENASQEVKMVLTGDGGDELFAGYDKYASFFSGECDRSHPRWFSDYAQFT
FT                   GLIEADMAKRLFKGEIKASFEENDPYAPITESMLRFGQDDHINKVLYADTVNLLPGNNL
FT                   VKPDRMAMAHSLEVRSPFLDYRLVEYAFSLPGKMKLKGTETKYIYKMAVEELLGETLTW
FT                   RKKQMFTVPVGDWFRGHLADFCSRILLDNRSLSRGLYAESVLREVIEDHTSARKNYTRL
FT                   LRALISLEIWFRLFIDQDMSNLELITSK"
     atgtgtggca tcttcggtgg tttctctttt gaagcaagtg ctttctcagg tgagctacct        60
     gtgatgatgg ctaagtcgat attgcaccga gggccggata atacgggcta ttggagtaat       120
     gaagaagcac tacttgggaa ttgtagactt tcgattattg acttatctaa gaatggcaat       180
     cagccatttt attcaaagaa caaggatata gtcgtagtgc aaaatggaga aatatacaat       240
     tatattgaat tgagagattt gttgattgga gagggcgctt gcttccagtc agatagtgac       300
     actgaggttg tattgcatgc atacgcgata tgggggcctg attttgttag taggttgaat       360
     ggaatgtttt cgattgctat ttatgattca cgagtttcta cagccgtgtt gcgcttatac       420
     cgtgaccgac ttggagtaaa gcccctttac tattgtattg acggtggttg cttatggttt       480
     ggatcagaaa ttaaggctat tttagcggca ggagtcaaag ccaatcccaa ttataatgca       540
     ttaagaagtt acttcgcgct aaactatatt cctcctccgc aaacagcttt tgcgaatatc       600
     tatcaccttc agccaggcca ttcggcggcg atcactaaaa gtggtgttaa attaaacaga       660
     tattgggatt gtaatgatat aggattaaat gaagatataa cgacggctga agcaaagtcg       720
     ggaataatta ctttattgga tgatgctgtt cgcatacgac ttagaagtga tgctccgttt       780
     ggtgcgttcc tttctggagg acttgacagc tccagtgtgg ttggacttat gagcctgtat       840
     aaggagtcgc ctacaaagac gttctctata ggctttgaag acgctcgata tgacgagaca       900
     agttatgcag aaatggcatc gaagcgattt ggaacttacc attcgaccaa gatcatgagt       960
     gagaatgcat tagacatatg gtcaaaattc atatggcatt gtgaccagcc tcatggagat      1020
     atttctttca taccgacata tcaagtctcg gaaaatgcgt ctcaggaagt aaagatggtt      1080
     ttaactggtg atggcggaga tgaattattc gctggctatg acaaatatgc aagtttcttc      1140
     agtggtgagt gtgatagaag tcatccgaga tggtttagcg attatgcaca atttacaggt      1200
     ctaatagaag cagatatggc aaagagactg ttcaagggtg aaataaaagc aagtttcgag      1260
     gagaacgatc cttacgctcc aatcactgaa tcaatgttac gttttggtca agatgaccat      1320
     atcaacaaag ttctgtatgc tgatacagta aatctcttgc caggaaacaa tcttgtaaaa      1380
     ccagatagaa tggcaatggc gcactcgtta gaagtccgct cgccattctt ggactatcgg      1440
     ttagtcgagt acgcgttttc tctgcctggt aaaatgaaac ttaagggcac ggaaacaaag      1500
     tatatttaca agatggccgt agaagaatta ctaggtgaaa cactaacgtg gcgaaaaaaa      1560
     caaatgttta cagttcctgt tggcgattgg ttcagggggc atttagccga tttttgctct      1620
     agaattttat tagataatag gtcactttct aggggactat acgcagaaag cgtgttacgc      1680
     gaagtaattg aagaccacac aagtgcacgc aagaattaca cgcggctgtt gagagcatta      1740
     atttctcttg agatttggtt cagattgttt attgatcagg atatgtctaa tttagagcta      1800
     atcacgtcaa aatag                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page