(data stored in SCRATCH3701 zone)

EMBL: CP000435.ASPB

CP000435.ASPB        Location/Qualifiers
FT   CDS_pept        complement(375875..377209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="sync_0372"
FT                   /product="aminotransferase, classes I and II"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45974"
FT                   /db_xref="GOA:Q0ID68"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID68"
FT                   /protein_id="ABI45974.1"
FT                   /translation="MGIWILLRVGRGDNHDHQGLLLSSYVAGCPQQPQSFVVKVNGNYL
FT                   KLKAGYLFPEIGRRVKAFSSANPEAQLIRLGIGDVTEPLPQACRDAMKSAIDEMGTAEG
FT                   FHGYGPEQGYAWLREAIARDDFQARGCEISAEEIFVSDGSKCDSSNILDILGSGNRIAV
FT                   TDPVYPVYVDSNVMAGRTGESGDDGRYGGLTYLPISADNGFAAQIPSEPVDLIYLCYPN
FT                   NPTGAVATKAQLKKWVDYARANKALILFDAAYEAFIQDPELPHSIYEIEGARDCAIEFR
FT                   SFSKNAGFTGTRCALTVVPKGLKGKADDGSEVELWGLWNRRQSTKFNGVSYIIQRGAEA
FT                   VYSDAGKQEVKALVSFYMENAAIIRRELSAAGIEVHGGQHAPYVWLKTPSGMDSWSFFD
FT                   HLLQKANVVGTPGSGFGAAGEGYFRLSAFNSRSNVDEAMARIRNL"
     gtggggatct ggatcctgct tcgtgtggga cggggcgaca atcacgacca ccagggcctg        60
     cttctttcat cgtatgtagc aggatgcccg cagcaacccc agtcattcgt ggtcaaggtc       120
     aacggcaatt acctgaaact caaagcgggt tatctgttcc cggagattgg ccgcagggtg       180
     aaagccttta gtagcgccaa ccccgaggcc cagctgattc gtctcggcat cggagatgtc       240
     acagagccgc taccgcaggc ctgccgtgat gccatgaaat cagccatcga cgagatgggt       300
     acggcggaag gattccacgg ctacggaccg gagcagggct atgcctggct tcgcgaagcg       360
     attgcccgcg atgactttca ggccaggggc tgtgagatca gcgcagagga gatctttgta       420
     tctgatggct ccaaatgcga tagcagcaat attctcgaca tccttgggag tggcaatcgc       480
     attgcagtca ccgatccggt gtatccggtc tatgtcgaca gcaatgtgat ggcaggccga       540
     acaggcgagt ctggtgacga cggtcgctat ggcggcctca cctacctgcc gatcagcgcc       600
     gacaacggtt ttgcagcgca gattccgagt gaacctgttg acctgatcta tctctgttat       660
     cccaacaacc ccaccggcgc tgtcgcaacg aaggcgcaac tcaagaagtg ggtggactat       720
     gcccgggcca acaaggcctt gatcctgttt gatgccgcat acgaagcgtt cattcaagat       780
     ccagagctgc cccattccat ttatgagatc gagggcgctc gagactgcgc gatcgaattc       840
     cgctccttct ccaaaaatgc cggattcaca ggcacccgtt gcgccttaac cgttgttccc       900
     aaagggctca aggggaaagc cgacgatggt tctgaggttg agctgtgggg gctgtggaac       960
     cgtcggcaaa gcaccaagtt caacggcgtg agctacatca ttcagcgggg cgcagaagcg      1020
     gtgtactccg acgcaggaaa acaggaggtg aaagcgctcg tgagcttcta tatggaaaat      1080
     gctgccatca tccgtcgcga gctcagtgct gcaggcattg aagttcatgg aggtcagcac      1140
     gccccctatg tgtggctgaa aacaccttca ggaatggact cctggagctt cttcgatcac      1200
     ctccttcaga aggccaatgt ggtgggaact ccaggtagtg gcttcggcgc tgcaggagaa      1260
     ggctatttcc gcctatccgc tttcaacagc cgtagcaatg tggacgaagc catggcccgc      1320
     attcgcaacc tttga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page