(data stored in SCRATCH3701 zone)

EMBL: CP000435.CLPP-1

CP000435.CLPP-1      Location/Qualifiers
FT   CDS_pept        complement(67336..68025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-1"
FT                   /locus_tag="sync_0065"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by similarity to SP:P19245; match to
FT                   protein family HMM PF00574; match to protein family HMM
FT                   TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46166"
FT                   /db_xref="GOA:Q0IE19"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE19"
FT                   /protein_id="ABI46166.1"
FT                   /translation="MINARSHHPIENRWRGTLPVSAHTPHASPGVPTVVEQSGRGERSF
FT                   DIYSRLLRERIIFLGTDVNDQVADALVAQLLFLEAEDPEKDIQVYINSPGGSITAGLAI
FT                   YDTMQQVAPDVVTICYGLAASMGAFLLSGGCKGKRLALPNARIMIHQPLGGAQGQAVDI
FT                   EIMAQEILFLKETLNGLMADHTGQPLAKITEDTERDYFLSPAEAVEYGLIDRVVDNLGG
FT                   EGIITGG"
     gtgatcaacg cccgcagcca ccacccgata gaaaaccgct ggcggggaac ccttcccgtc        60
     tccgctcaca caccgcatgc ctctcctggg gttcccacgg tggttgagca gtccgggcgg       120
     ggtgaacgct cgtttgatat ttattcccgt ctgctcaggg agagaatcat ctttctggga       180
     accgatgtaa acgaccaggt ggcggatgct ctggttgctc aacttctgtt tctagaagca       240
     gaagaccccg aaaaagacat tcaggtgtat atcaattcac cgggtggatc aattactgca       300
     ggcttggcga tctacgacac gatgcagcag gtggctcctg acgtcgtcac gatctgctac       360
     ggcctcgccg cctcaatggg cgcttttctg ctgagcggag gctgcaaagg caaacgctta       420
     gccctgccca acgccaggat catgatccac caacccttag ggggtgccca aggtcaggcc       480
     gtggacatcg aaatcatggc gcaggaaatt ttatttctta aggaaaccct gaacggcctg       540
     atggcggacc ataccggcca gccgctcgcc aaaatcaccg aggacaccga acgggactac       600
     ttcctttctc cggcagaagc ggttgaatac ggattgatcg atcgcgttgt ggacaatctc       660
     ggaggcgaag gaatcattac ggggggctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page