(data stored in SCRATCH3701 zone)

EMBL: CP000435.CLPS-1

CP000435.CLPS-1      Location/Qualifiers
FT   CDS_pept        complement(375522..375833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpS-1"
FT                   /locus_tag="sync_0371"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="identified by match to protein family HMM PF02617"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46551"
FT                   /db_xref="GOA:Q0ID69"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID69"
FT                   /protein_id="ABI46551.1"
FT                   /translation="MVDTPSRSPGGAAVLDKQTERVRKTSPRYKVLLHNDPVNSMEYVV
FT                   VTLQQVVPQLSEQDAMAVMLETHNTGIGLVIVCDIEPAEFYCETLKNKGLTSTIEPES"
     atggtggaca cacccagccg tagccccggt ggggctgcgg ttcttgacaa gcaaaccgag        60
     cgggtgcgta agacatcgcc ccgctacaag gttttgcttc acaacgaccc tgtcaacagc       120
     atggagtacg tcgttgtcac ccttcagcag gtggttcccc agctcagtga gcaggatgca       180
     atggccgtga tgctggaaac ccacaacacc ggaatcggtc tcgtgatcgt ttgcgacatt       240
     gaacccgctg agttctattg cgaaaccctg aagaacaagg gcctgaccag caccatcgaa       300
     ccagaaagct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page