(data stored in SCRATCH3701 zone)

EMBL: CP000435.CPAB-1

CP000435.CPAB-1      Location/Qualifiers
FT   CDS_pept        484551..485105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB-1"
FT                   /locus_tag="sync_0495"
FT                   /product="C-phycoerythrin class I beta chain"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46374"
FT                   /db_xref="GOA:Q0ICV0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV0"
FT                   /protein_id="ABI46374.1"
FT                   /translation="MLDAFSRSVVSADAKTAPVGGSDLAGLRSYVRDGNKRLDAVNAIT
FT                   SNASCIVSDAVTGMICENTGLIQAGGNCYPNRRMAACLRDGEIVLRYISYALLAGDASV
FT                   LDDRCLNGLKETYIALGVPTQSAGRAVAIMKASATAHIGETNTPGLGGKRFRKMETTQG
FT                   DCASLVAEAGAYFDRVIGAIS"
     atgctcgacg cattctcacg ttcggtcgtc agtgccgacg ccaaaactgc tcccgttggt        60
     ggtagtgacc tcgcaggtct ccgctcctac gttcgtgacg gcaataagcg tctcgatgcc       120
     gtcaacgcca tcacctcaaa cgcctcctgc atcgtttctg atgctgttac gggcatgatt       180
     tgtgaaaaca caggtctgat ccaggcaggt ggcaattgct atcccaaccg tcgtatggca       240
     gcttgcctgc gcgacggaga gatcgttctc cgctacatca gctatgccct tttggcaggc       300
     gatgcatccg ttcttgatga tcgttgcctg aatggtctga aggaaaccta cattgcactg       360
     ggcgttccta cccagtctgc aggtcgtgcc gtggccatca tgaaggcttc tgcgactgct       420
     cacatcggag aaaccaacac tcctggttta ggtggtaagc gtttccgtaa aatggaaacc       480
     acacagggtg actgtgcctc tctggtcgca gaagcaggtg cttatttcga tcgcgtcatc       540
     ggcgccattt cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page