(data stored in SCRATCH3701 zone)

EMBL: CP000435.CPEC

CP000435.CPEC        Location/Qualifiers
FT   CDS_pept        complement(499633..500517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeC"
FT                   /locus_tag="sync_0513"
FT                   /product="phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427;
FT                   match to protein family HMM PF01383"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45980"
FT                   /db_xref="GOA:Q0ICT2"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT2"
FT                   /protein_id="ABI45980.1"
FT                   /translation="MPFGPASLLGVERFSAESEAPLELLPGDDDTQKEALIRAIYKQVL
FT                   GNAYVMESERQLIAESQFKLGEISVRELIRRIAKSDLYRSRFFESCPRYRYIELAFRHF
FT                   LGRAPVDFDEMRAHAERLDSLGFEADIDSYLDSDDYQNSYGEWIVPYQRGWKTESCKTL
FT                   QEFTWSFQLLRGNSSSSLKGDLSGITAKLGGAAYQNLPLAVVPPSSKEATGWSFRRAKN
FT                   LQDAPTRLGVGAGQEGTTYRVEVTGYRANNVRRISRYTKSNRVFYIPFDKLSEQFIRIH
FT                   REGGKISSITPVT"
     atgccctttg gtcctgcctc gctcctaggg gtcgagcgtt tctccgcaga gagtgaagca        60
     ccgctcgaac tgcttccagg cgacgacgac acccaaaagg aagccctcat acgcgctatc       120
     tacaagcaag tgcttggcaa tgcctacgtg atggagagcg aacggcaatt gatcgccgaa       180
     tcccagttca agcttgggga aatcagcgtt cgtgagctca tccgacgaat cgcgaaaagc       240
     gacttatatc gaagccgatt tttcgagtcc tgcccgcgct atcgatacat cgaacttgcc       300
     ttcagacatt tcttaggaag agccccggtc gattttgatg aaatgcgcgc gcatgctgaa       360
     cgtcttgaca gtttgggatt tgaggccgat atagatagct atttggattc tgatgactat       420
     cagaattcat acggggagtg gattgtgccc tatcagcgtg gctggaagac ggagagctgc       480
     aaaacccttc aagagttcac atggagtttc caacttcttc gtggcaacag tagtagcagt       540
     ctgaaaggtg acctatcagg aatcacagca aaacttggag gggctgccta ccaaaacctt       600
     ccactcgctg ttgtcccacc atcatccaaa gaagcaactg gatggagctt taggagagcc       660
     aaaaatcttc aagatgcacc tacacgcctc ggcgttggag caggccaaga agggaccaca       720
     tatcgcgttg aggtaactgg atatagagct aacaatgtac gtcgaatatc acgatacaca       780
     aaatcaaata gagtctttta cattcccttc gacaaactct cagagcaatt cataagaata       840
     catcgtgaag ggggtaaaat ttccagcatt acaccagtca cttaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page