(data stored in SCRATCH3701 zone)

EMBL: CP000435.CPED-1

CP000435.CPED-1      Location/Qualifiers
FT   CDS_pept        complement(497117..497851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeD-1"
FT                   /locus_tag="sync_0511"
FT                   /product="possible phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47671"
FT                   /db_xref="GOA:Q0ICT4"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT4"
FT                   /protein_id="ABI47671.1"
FT                   /translation="MSQPLTLATKANIDLDHSNDVIKRIYRQVFGNRHLMELDINQSLE
FT                   ALFINGDLTVQGFVTALAQSDTYKKLFLETNSPYKFVELNFKHLLGRAPHDQSEIMEHV
FT                   KLLSEEGYENEIASYTYSEEYLTAFGIDQVPYSRGSNTMQGGSTINYTRTNASEVGYAG
FT                   YDGAQKSSRLLQSLTTGSIPDISQRKGVGNGGALTISWTSRKQIGANRRVGQKSVVSQA
FT                   SMSSTIKSILAQGGKILSITKA"
     atgtctcaac cactcaccct tgccaccaaa gcaaatattg atcttgatca ctcaaatgat        60
     gtgatcaaaa gaatctatag gcaagtgttc ggcaatcgac atctgatgga gttggatatc       120
     aatcaatcat tagaagcttt attcattaat ggagatttaa cagtacaggg gtttgtaaca       180
     gcgctggcac agtcagacac ctacaaaaag ctcttccttg agaccaatag tccttataaa       240
     tttgttgagc taaatttcaa acatcttcta ggtcgtgctc cccatgacca aagcgaaatc       300
     atggagcatg taaaactcct aagcgaagaa ggctacgaaa acgaaattgc aagctacaca       360
     tacagtgaag agtatttaac tgcgtttgga attgatcaag ttccttacag tcgtggatct       420
     aatacaatgc agggtggaag tacaatcaat tacacaagaa ccaacgcctc tgaagttgga       480
     tacgcaggat acgatggggc ccagaaatct tctagacttt tacaaagcct aacaacaggt       540
     tcgattcctg atatcagtca gaggaaagga gttggaaatg gtggagcatt aaccataagc       600
     tggacatcac gaaagcagat tggtgccaat cgtcgagtcg ggcaaaaatc agttgtcagc       660
     caggcatcaa tgtcatcaac gatcaaaagc atcctcgctc aaggcgggaa gatcctgagt       720
     attacaaagg cttaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page