(data stored in SCRATCH3701 zone)

EMBL: CP000435.CRCB

CP000435.CRCB        Location/Qualifiers
FT   CDS_pept        100098..100493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="sync_0095"
FT                   /product="crcB protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47095"
FT                   /db_xref="GOA:Q0IDZ0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ0"
FT                   /protein_id="ABI47095.1"
FT                   /translation="MPQSSSSVTGQLSLRQDLNELALVALGAVPGAVMRWQIASHFHDK
FT                   DLIVNVLGAFILGWLVGLPLRPKRQLLIGIGFCGSLTTFSSWMVHCVTFIAQGDWLSAL
FT                   GLIGLTLGLGLGAAALGVLVGRSLVRR"
     atgcctcaat cttcttcctc tgtgaccgga cagctcagcc ttcggcaaga cctgaacgaa        60
     ttggctctag tggcgcttgg tgctgttcct ggtgctgtga tgcgctggca aattgcgtct       120
     cacttccatg acaaagacct gattgtgaac gtgctcggag cgttcatttt gggttggttg       180
     gtcgggcttc ctctaagacc gaagcgtcag ttgttgatcg ggattggttt ctgcggttcg       240
     cttaccacgt tcagtagctg gatggtgcat tgcgtgacct tcatcgccca aggtgactgg       300
     ctttctgccc tggggttgat tggcctcacc ctggggctgg ggcttggtgc cgcagccctg       360
     ggagtcttag tcggccggag tttggttagg cgttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page