(data stored in SCRATCH3701 zone)

EMBL: CP000435.ENGA

CP000435.ENGA        Location/Qualifiers
FT   CDS_pept        565834..567201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="sync_0596"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46603"
FT                   /db_xref="GOA:Q0ICK8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICK8"
FT                   /protein_id="ABI46603.1"
FT                   /translation="MARPVVAIIGRPNVGKSTLVNRLCRSREAIVHDQPGVTRDRTYQD
FT                   GYWGDREFKVVDTGGLVFDDDSEFLPEIREQASLALAEASVALVIVDGQQGLTAADESI
FT                   AEWLRTQNCKTLLAVNKCESPEQGLGMAAEFWRLGLGEPHPISAIHGAGTAELLDQVLT
FT                   FLPPKDEESDEEEPIQLSIIGRPNVGKSSLLNSICGETRAIVSPIRGTTRDTIDTRIER
FT                   ENRRWRLIDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEEDGRACVVVVNKWDAVEKDSHTMTAMEKELRAKLYFLDWAPMLFTSALTGQRVDS
FT                   IFALAALAVEQHRRRVSTSVVNEVLKEALSWRSPPTTRGGRQGRLYYGTQVASRPPSFT
FT                   LFVNEPKLFGDTYRRYVERQIREGLGFDGTPVKLFWRGKQQRDAEKELVRQQNRQG"
     ttggcacgtc cggtcgtcgc aatcatcggg cgtcccaacg tcggcaagtc caccttggtg        60
     aaccgtctct gtagaagtcg tgaggccatc gttcacgacc agccaggtgt gacgcgagat       120
     cgcacttatc aagacgggta ttggggcgat cgagaattca aggtggtgga caccggaggc       180
     ttggtgttcg atgacgacag tgagttcctt cctgagatcc gggagcaggc cagcctcgct       240
     ctcgctgaag ccagcgtggc gttggtgatt gtggatggtc agcagggact cacggctgcg       300
     gatgaatcga tcgcggaatg gctgcgtacg cagaactgca agaccttgtt agcggttaat       360
     aagtgtgagt ctcccgagca gggattaggc atggccgcgg agttttggcg gctcggtctt       420
     ggtgaacccc atccgatttc ggcgatccat ggtgctggca ccgctgagct gctcgatcag       480
     gtgctcacct ttcttccgcc caaggatgag gagagtgatg aagaggagcc aattcagctt       540
     tcgattattg gccgtcccaa tgtggggaag tccagcttgc tgaattccat ctgtggtgag       600
     acgcgggcca ttgtgagtcc gattcgtggc accacccgcg ataccattga tacgcgcatt       660
     gaacgggaaa atcgtcgctg gcgattgatt gacactgcag gaatacgccg gcgtcgcagc       720
     gtgaattacg gcccagaatt ttttgggatt aaccgcagtt ttaaagcgat cgaacgcagt       780
     gatgtctgcg ttctagtgat cgatgctctc gatggtgtga ccgagcagga tcaacgcttg       840
     gcgggacgga tcgaagagga cggccgagct tgcgtggttg tggtgaataa gtgggatgcg       900
     gtggaaaaag acagccatac gatgacagcg atggaaaagg agctgcgcgc caagctctat       960
     ttcctggatt gggctccaat gttgttcacc tctgcgctga cagggcaacg ggtcgacagc      1020
     attttcgcct tggcggctct tgctgtggaa cagcaccgcc gcagggtgag cacatcagtt      1080
     gtgaacgaag tgcttaagga agccctcagc tggcggagtc cccccaccac ccgtggaggc      1140
     cggcagggcc gcttgtatta cggcacccag gtggcgagtc gtccgcccag tttcaccttg      1200
     ttcgtgaatg agcccaagct gtttggcgat acctatcgcc gctacgtgga acgtcaaatc      1260
     cgtgaaggcc tcggctttga cgggactcca gtgaagctgt tctggcgagg caagcaacag      1320
     cgggatgcag agaaggagct ggtccgccag cagaatcgcc aaggctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page